powered by:
Protein Alignment Rad60 and W09C3.3
DIOPT Version :9
Sequence 1: | NP_001262867.1 |
Gene: | Rad60 / 42748 |
FlyBaseID: | FBgn0039065 |
Length: | 424 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_491428.3 |
Gene: | W09C3.3 / 189311 |
WormBaseID: | WBGene00021111 |
Length: | 297 |
Species: | Caenorhabditis elegans |
Alignment Length: | 71 |
Identity: | 16/71 - (22%) |
Similarity: | 28/71 - (39%) |
Gaps: | 23/71 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 161 GQKKRTSLTTTTSNSASMEVSLPSIVGQNNEHISRRWTLAEVAARSKVVDSIDLVSAVAPRVEGF 225
|:|...|:.:..|... .:|:|.: |:...:.|.||.. .||:| :
Worm 167 GEKAGFSMASVLSKGE--YISMPVV------HVDLYYFLKEVLG-EKVID--------------Y 208
Fly 226 VNLDSE 231
:.:|||
Worm 209 LWMDSE 214
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Rad60 | NP_001262867.1 |
UBQ |
<392..422 |
CDD:294102 |
|
W09C3.3 | NP_491428.3 |
Methyltransf_21 |
<134..285 |
CDD:377448 |
16/71 (23%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5227 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.