DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4467 and Erap1

DIOPT Version :10

Sequence 1:NP_001036747.1 Gene:CG4467 / 42747 FlyBaseID:FBgn0039064 Length:1125 Species:Drosophila melanogaster
Sequence 2:NP_109636.1 Gene:Erap1 / 80898 MGIID:1933403 Length:930 Species:Mus musculus


Alignment Length:47 Identity:17/47 - (36%)
Similarity:21/47 - (44%) Gaps:10/47 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 FNRSWEKY----RDGFGDIGTEYWLGL----DEIH-RLTVAVPHEIA 231
            ::.||..|    ||.|.|...|. ||:    |.|. .||.|:...||
Mouse   452 YHESWPCYARTLRDRFSDTTIEV-LGMMDDDDNIDLELTAALIRHIA 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4467NP_001036747.1 GluZincin 145..677 CDD:472708 17/47 (36%)
ERAP1_C 783..1078 CDD:463368
Erap1NP_109636.1 M1_APN-Q_like 50..515 CDD:341064 17/47 (36%)
ERAP1_C 586..905 CDD:463368
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.