DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fzo and Opa1

DIOPT Version :9

Sequence 1:NP_732840.1 Gene:fzo / 42745 FlyBaseID:FBgn0011596 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_725369.1 Gene:Opa1 / 36578 FlyBaseID:FBgn0261276 Length:972 Species:Drosophila melanogaster


Alignment Length:518 Identity:96/518 - (18%)
Similarity:174/518 - (33%) Gaps:135/518 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KTELQDIYHDLSNYLSNFLTILEETVLLKDRQMLEHLCAFSSRVEAIAKVLSRDRMKVAFFGRTS 96
            |..|.|:|.::.:.||.:.|         ...|.:||                  .:|...|..|
  Fly   272 KKSLIDMYSEVLDELSGYDT---------GYTMADHL------------------PRVVVVGDQS 309

  Fly    97 NGKSAVINALLHEKILPSAMGHTTSCFCQVQANGSNETEHV-KVEQEDEHMELSALSQLASAHSP 160
            :||::|:.::...:|.|...|...: ...|:...:....|| :....|...:|:..|.|..    
  Fly   310 SGKTSVLESIAKARIFPRGSGEMMT-RAPVKVTLAEGPYHVAQFRDSDREYDLTKESDLQD---- 369

  Fly   161 GALKPSTLLQVNMAKNRCSILDYDV-------------VLMDTPGVDVTAQLD---DCLDS---- 205
              |:.....::..:......:..:|             ||:|.||:..|..:|   |..||    
  Fly   370 --LRRDVEFRMKASVRGGKTVSNEVIAMTVKGPGLQRMVLVDLPGIISTMTVDMASDTKDSIHQM 432

  Fly   206 ---YCMDADVFILVLNAESTVSRVERQFFKDVASK---LSRPNLFILNNRWDKASSL-EPEMEQK 263
               |..:.:..||.:...|.  ..||....|:..:   |.|..:|:| .:.|.|..| :|:..:|
  Fly   433 TKHYMSNPNAIILCIQDGSV--DAERSNVTDLVMQCDPLGRRTIFVL-TKVDLAEELADPDRIRK 494

  Fly   264 VKDQHMERCVNLLVDELGVYSTAQEAWERIYHVSALEALHIRNGQITNPSGQTQQRYQEFLRFEN 328
            :....:     ..:..||.|:                        :....|:.........::|.
  Fly   495 ILSGKL-----FPMKALGYYA------------------------VVTGRGRKDDSIDAIRQYEE 530

  Fly   329 DFSNCLAVSALKTKFGPHLLSAQKILNQLKSTLICPFIEKVSRLIDENKERRANLNAEIEDWLIL 393
            ||.....:...:....||.::::.:...:.........|.:.:..|..|..|.||..|   |   
  Fly   531 DFFKNSKLFHRRGVIMPHQVTSRNLSLAVSDRFWKMVRETIEQQADAFKATRFNLETE---W--- 589

  Fly   394 MQEDREALQYCFEELTEMTQRVGRCVLNDQIKTLIPSSVLSFSQPFHPEFPAQIGQYQRSLCAHL 458
                    :..|..|.|.    ||..|.|:.|..|...|::.||       ....::..:|...|
  Fly   590 --------KNNFPRLRES----GRDELFDKAKGEILDEVVTLSQ-------ISAKKWDDALSTKL 635

  Fly   459 DKLLEDRVLQCLSIPLQRK--------ILDIE----KEIGLPIAENSCDWQLIYGLDCQSYMS 509
            .:.|.:.|.:.:.:|..:.        ::||:    .|..||.......|:.:.    |.::|
  Fly   636 WEKLSNYVFESIYLPAAQSGSQNSFNTMVDIKLRQWAEQALPAKSVEAGWEALQ----QEFIS 694

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzoNP_732840.1 DLP_2 87..334 CDD:206739 51/274 (19%)
Fzo_mitofusin 572..716 CDD:282633
Opa1NP_725369.1 DLP_1 298..572 CDD:206738 56/330 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0699
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.