DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fzo and Dnm1

DIOPT Version :9

Sequence 1:NP_732840.1 Gene:fzo / 42745 FlyBaseID:FBgn0011596 Length:718 Species:Drosophila melanogaster
Sequence 2:XP_006497725.1 Gene:Dnm1 / 13429 MGIID:107384 Length:914 Species:Mus musculus


Alignment Length:610 Identity:116/610 - (19%)
Similarity:205/610 - (33%) Gaps:201/610 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GESTSSVSSFISSSSSSRLSEFVDAKTELQDIYHDLSNYLSNFLTILEETVLLKDRQMLEHLCAF 71
            |.|.......|..|::..:|  ||.|.    :.|.||..|.:.:..|..|:......:.:|    
Mouse     2 GFSPERRDEIIQCSAAGEVS--VDPKI----LQHFLSRCLVSSVLSLCSTLGPPAHPLSQH---- 56

  Fly    72 SSRVE-------------AIAKVLSRDRMKVAFFGRTSNGKSAVINALLHEKILPSAMGHTTSCF 123
            ||||.             ::...||. |..::...|...|      |......||...|..|...
Mouse    57 SSRVAGQSICCLWPCLEFSVGAGLSH-RTSLSIPTRHPGG------AKDERDFLPRGSGIVTRRP 114

  Fly   124 CQVQANGSN----ETEHVK----VEQEDEHMELSALSQLASAHSPGALKPSTLLQVNMAKNRCSI 180
            ..:|...|.    |..|.|    .:.|:..:|:.|.:...:..:.| :.|   :.:|:......:
Mouse   115 LVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKG-ISP---VPINLRVYSPHV 175

  Fly   181 LDYDVVLMDTPGV----------DVTAQLDDCLDSYCMDADVFILVLNAESTVSRVERQFFKDVA 235
            |  ::.|:|.||:          |:..|:.|.|..:....:..||.::..::             
Mouse   176 L--NLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANS------------- 225

  Fly   236 SKLSRPNLFILNNRWDKASSLEPEMEQKVKDQHMERCVNLL--VDELGVYSTAQEAWERIYHVSA 298
                           |.|:|...::.::| |...:|.:.::  :|.:...:.|::..|.      
Mouse   226 ---------------DLANSDALKIAKEV-DPQGQRTIGVITKLDLMDEGTDARDVLEN------ 268

  Fly   299 LEALHIRNGQITNPSGQTQQRYQEFLRFENDFSNCLAVSA-----------LKTKFG-PHLLSAQ 351
             :.|.:|.|.|     ....|.|:.:..:.|.:..||...           |..:.| |:|   |
Mouse   269 -KLLPLRRGYI-----GVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYL---Q 324

  Fly   352 KILNQ----------------LKSTLICPFIEKVSRLIDENKERRANLNAEIEDWLILMQEDREA 400
            |:|||                |:|.|:     .:.:.:||.|..|.:..|.....|:.|.:    
Mouse   325 KVLNQQLTNHIRDTLPGLRNKLQSQLL-----SIEKEVDEYKNFRPDDPARKTKALLQMVQ---- 380

  Fly   401 LQYC--FEELTEMTQRVGRCVLNDQIKTLIPSSVLSFSQPFHPEFPAQIGQYQRSLCAHLDKLLE 463
             |:.  ||:..|.:        .|||.|...|.....::.||..||.::                
Mouse   381 -QFAVDFEKRIEGS--------GDQIDTYELSGGARINRIFHERFPFEL---------------- 420

  Fly   464 DRVLQCLSIPLQRKILDIEKEIGLPIAENSCDWQLIYGLDCQSYMSDFQPDLRFRFSLGFTALWH 528
                    :.::....::.:||...|..       |:|:    ....|.|||.|..::       
Mouse   421 --------VKMEFDEKELRREISYAIKN-------IHGI----RTGLFTPDLAFEATV------- 459

  Fly   529 RLEGNLPLHASPFRIQKLQNGHKKC 553
                       ..::|||:....||
Mouse   460 -----------KKQVQKLKEPSIKC 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzoNP_732840.1 DLP_2 87..334 CDD:206739 45/266 (17%)
Fzo_mitofusin 572..716 CDD:282633
Dnm1XP_006497725.1 DLP_1 100..340 CDD:206738 53/289 (18%)
Dynamin_M 262..548 CDD:366427 58/298 (19%)
PH_dynamin 566..675 CDD:269958
GED 702..791 CDD:366984
PHA03247 <793..910 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0699
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.