DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnc and bach1b

DIOPT Version :9

Sequence 1:NP_001262864.1 Gene:cnc / 42743 FlyBaseID:FBgn0262975 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_001371076.1 Gene:bach1b / 553688 ZFINID:ZDB-GENE-050522-220 Length:632 Species:Danio rerio


Alignment Length:418 Identity:95/418 - (22%)
Similarity:153/418 - (36%) Gaps:113/418 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   975 YDFSYNNNSRLSTATRQPPVAQKKHQLYGKRDPHKQTPSALPPTAPPAAATAVQSQSIKYEYDAG 1039
            ||.|.|   .|...:.:.|:.:.:..|..:..|....|....|:. ||...:.||          
Zfish   242 YDCSLN---CLPCTSNKTPITEDEDSLLPECSPLNPDPCTDQPSF-PACNESAQS---------- 292

  Fly  1040 YASSGMASGGISEPGAMGPALSKDYHHHQPYGMGASGSAFSGDYTVRPSPRTSQ-----DLVQLN 1099
                 |...|.|:...|.|....|  |.:...|.......:|:.:........|     |..||:
Zfish   293 -----MCDSGDSDKPGMLPQSGLD--HTERADMEFKEDQSNGERSTEEIEVARQLTFWTDSGQLS 350

  Fly  1100 HTYSLPQGSGSLPRPQARD------------KKPLVATKTA-------SKGASA--------GNS 1137
                 |.|.|.:.:|...:            :.|.|.:..|       .:|.|.        .|.
Zfish   351 -----PSGLGLVDKPSGLNCLKTCYLDPRAVECPFVLSFGAVGAQLHDGEGGSVSQGSPYVQSNQ 410

  Fly  1138 SSVGGNSSNLEEEHLTRDEKRARSLNIPISVPDIINLPMDEFNERLSKYDLSENQLSLIRDIRRR 1202
            |....:|.:.|.:..:...:|.|.:.:|:||..|:.|..::|.:.|.:..||..||..:.|||||
Zfish   411 SGEDSDSFDTEGDSESYSSERVREMALPLSVDQIVCLSRNDFQQMLKQQSLSREQLDAVHDIRRR 475

  Fly  1203 GKNKVAAQNCRKRKLDQILTLEDEVNAVVKRKTQLNQDRDHLESERKRIS-------NKFAMLHR 1260
            .||::||:.|||||||.|..||.|:.       :|..:|:.|.|||.:::       ..::.|:.
Zfish   476 SKNRIAARRCRKRKLDCIHNLECEIE-------KLRCEREKLTSERVKLNQLKLKAWQSYSGLYE 533

  Fly  1261 HV----------FQYLRDPEGNPC-------------------SPADYSLQQAADGSVY-LLPR- 1294
            .|          .|.|.......|                   :|...|::..|..:.: |||: 
Zfish   534 QVCAEAALRPEQLQVLAKYSSPDCPLSALLYPDPTHSSGSGDQTPVRSSMENTAQSNSHKLLPQS 598

  Fly  1295 ----------EKSEGNNTATAASNAVSS 1312
                      :|||.::....|:..:.|
Zfish   599 HPSPVDATAFDKSECSSMVKRATELLIS 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cncNP_001262864.1 bZIP_CNC 1192..1259 CDD:269846 28/73 (38%)
coiled coil 1193..1255 CDD:269846 27/68 (40%)
bach1bNP_001371076.1 BTB_POZ_BACH 35..128 CDD:349736
bZIP 462..532 CDD:419672 29/76 (38%)
coiled coil 466..528 CDD:269834 27/68 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3863
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.