DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnc and Nfe2

DIOPT Version :9

Sequence 1:NP_001262864.1 Gene:cnc / 42743 FlyBaseID:FBgn0262975 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_001012224.1 Gene:Nfe2 / 366998 RGDID:1306888 Length:373 Species:Rattus norvegicus


Alignment Length:396 Identity:119/396 - (30%)
Similarity:175/396 - (44%) Gaps:90/396 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   947 RVPSLSDGEWGEGSDSAQDYH-----QG---------------KYGGPYDFSYNNNSRLSTATRQ 991
            |:|.|..||.||...:.|:..     ||               .|.||.               .
  Rat    12 RLPQLPTGELGEMELTWQEIMSITELQGLNVPSEPSFEPQAPTPYPGPL---------------P 61

  Fly   992 PPVAQKKHQLYGKRDPHKQTPSALPPTAPPAAATAVQSQSIKYEY-------DAGYASSGMASGG 1049
            ||.       |.....|......|||......|:...:..:.|.|       ......||:.:..
  Rat    62 PPT-------YCPCSIHPDAGFTLPPPPYELPASTPHAPDLPYSYGNIAIPVSKPLTLSGLLNEP 119

  Fly  1050 ISEPGAM---GPALSKDYHHHQPYGMGASGSAFSGDYT---------VRPSPRTSQ--DLVQLNH 1100
            :.:|.|:   |..:.:......|    .|.|..|.:|:         .....|.|:  |:..:.:
  Rat   120 LPDPLALLDIGLPVGQPKPQEDP----ESDSGLSLNYSDAESLELEGTEAGRRRSEYVDMYPVEY 180

  Fly  1101 TYSLPQGSGSLPR---PQARDKKPLVATKTA----SKGASAGNSSSVGGNSSNLEEEHLTRDEKR 1158
            .|||...|.:.|.   |..  :.|||...::    :|.|..|.:.|              |||:|
  Rat   181 PYSLMPNSLAHPNYTLPPT--ETPLVLESSSGPVRAKPAVRGEAGS--------------RDERR 229

  Fly  1159 ARSLNIPISVPDIINLPMDEFNERLSKYDLSENQLSLIRDIRRRGKNKVAAQNCRKRKLDQILTL 1223
            |.::.||.....|:|||:|:|||.|::|.|:|:||:|:|||||||||||||||||||||:.|:.|
  Rat   230 ALAMKIPFPTDKIVNLPVDDFNELLAQYPLTESQLALVRDIRRRGKNKVAAQNCRKRKLETIVQL 294

  Fly  1224 EDEVNAVVKRKTQLNQDRDHLESERKRISNKFAMLHRHVFQYLRDPEGNPCSPADYSLQQAADGS 1288
            |.|:..:...:.:|.:.|...:...:.:..:...|:..:||:|||..||..||.:|.|||||||:
  Rat   295 ERELERLGSERERLLRARGEADRTLEVMRQQLTELYHDIFQHLRDESGNSYSPEEYVLQQAADGA 359

  Fly  1289 VYLLPR 1294
            ::|:||
  Rat   360 IFLVPR 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cncNP_001262864.1 bZIP_CNC 1192..1259 CDD:269846 30/66 (45%)
coiled coil 1193..1255 CDD:269846 29/61 (48%)
Nfe2NP_001012224.1 Transactivation domain. /evidence=ECO:0000250 1..206 45/221 (20%)
Required for interaction with MAPK8. /evidence=ECO:0000250 1..83 20/92 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 5/9 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..60 2/19 (11%)
PXY motif 1 61..65 2/10 (20%)
PXY motif 2 79..83 2/3 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..163 5/35 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..225 4/32 (13%)
bZIP_NFE2-like 263..330 CDD:269868 30/66 (45%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 268..287 18/18 (100%)
coiled coil 269..320 CDD:269868 26/50 (52%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 291..298 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I6996
eggNOG 1 0.900 - - E1_KOG3863
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1095280at2759
OrthoFinder 1 1.000 - - FOG0002254
OrthoInspector 1 1.000 - - otm45530
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24411
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.