DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnc and nfe2l2a

DIOPT Version :9

Sequence 1:NP_001262864.1 Gene:cnc / 42743 FlyBaseID:FBgn0262975 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_878309.1 Gene:nfe2l2a / 360149 ZFINID:ZDB-GENE-030723-2 Length:586 Species:Danio rerio


Alignment Length:334 Identity:114/334 - (34%)
Similarity:172/334 - (51%) Gaps:31/334 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   973 GPYDFSYNNNSRLSTATRQPPVAQKKHQLYGKRDPHKQTPSALPPTAPPAAATAVQSQSIKY-EY 1036
            ||.:|:......:......||:......:.|  || ...|..|...:|...::......::: :.
Zfish   267 GPEEFNELFYPEMEVKVNNPPITSDGGNMVG--DP-PVNPIDLQSFSPGDFSSGKPDPIVEFQDS 328

  Fly  1037 DAGY---ASSGMASGG--ISEPGAMGPALSKDYHHHQPYGMGASGSAFSGDYT-VRPSPRTSQDL 1095
            |:|.   ||..|:|.|  |:|.|:.|      :.......|..|..:...||. :.|       |
Zfish   329 DSGLSLDASPHMSSPGKSITEDGSFG------FSDSDSEEMEGSPGSMESDYNEIFP-------L 380

  Fly  1096 VQLNHTYSLPQGSGSLPRPQARDKKPLVATKTASKGASAGNSSSVGGNSSNLE---EEHLTRDEK 1157
            |.||.....|     |....:.:|:.:.......:.|.|...|........|:   |..|:|||:
Zfish   381 VYLNDGSQTP-----LSEKSSTEKQEMKLKNPKMEPAEASGHSKPPFTKDKLKKRSEARLSRDEQ 440

  Fly  1158 RARSLNIPISVPDIINLPMDEFNERLSKYDLSENQLSLIRDIRRRGKNKVAAQNCRKRKLDQILT 1222
            ||::|.||.:|..|||||:|:|||.:||:.|:|.||:|:|||||||||||||||||||||:.|:.
Zfish   441 RAKALQIPFTVDMIINLPVDDFNEMMSKHQLNEAQLALVRDIRRRGKNKVAAQNCRKRKLENIVG 505

  Fly  1223 LEDEVNAVVKRKTQLNQDRDHLESERKRISNKFAMLHRHVFQYLRDPEGNPCSPADYSLQQAADG 1287
            ||.|::::.:.|.:|.:::....|..|.:..:.:.|::.||..|||..|...||.::|||..|||
Zfish   506 LEYELDSLKEEKERLMKEKSERSSNLKEMKQQLSTLYQEVFGMLRDENGKAFSPNEFSLQHTADG 570

  Fly  1288 SVYLLPREK 1296
            :|:|:||.|
Zfish   571 TVFLVPRLK 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cncNP_001262864.1 bZIP_CNC 1192..1259 CDD:269846 32/66 (48%)
coiled coil 1193..1255 CDD:269846 31/61 (51%)
nfe2l2aNP_878309.1 bZIP_NFE2-like 475..542 CDD:269868 32/66 (48%)
coiled coil 476..538 CDD:269868 31/61 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7252
eggNOG 1 0.900 - - E1_KOG3863
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 187 1.000 Inparanoid score I3907
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1095280at2759
OrthoFinder 1 1.000 - - FOG0002254
OrthoInspector 1 1.000 - - otm24377
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24411
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4312
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.960

Return to query results.
Submit another query.