DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnc and sknr-1

DIOPT Version :9

Sequence 1:NP_001262864.1 Gene:cnc / 42743 FlyBaseID:FBgn0262975 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_001303755.1 Gene:sknr-1 / 189139 WormBaseID:WBGene00020961 Length:385 Species:Caenorhabditis elegans


Alignment Length:271 Identity:64/271 - (23%)
Similarity:92/271 - (33%) Gaps:83/271 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   976 DFSYNNNSRLSTATRQPPVAQKKHQLYGKRDPHKQTPSALPPT------------------APPA 1022
            ||.  |.|.:||...||      ...:...|  .||.....||                  ...:
 Worm   163 DFC--NQSSISTIAAQP------QSFFHSAD--SQTVEQWLPTDVVLNEVFPTSNYEYIGMQNDS 217

  Fly  1023 AATAVQSQSIKYEYDA-GYASS----GMASGGISEPGAMGP-------ALSKDYHHHQPYGMGAS 1075
            ....|.::.|.|.|.: |...:    |...||..:...|.|       ..|.|.:|.|.:.....
 Worm   218 LQAVVSNEQIDYAYQSIGQTQTPLNIGSTIGGGPQQTQMSPESVTVTATASFDLYHSQKHSFSER 282

  Fly  1076 GSAFSGDYTVRPSPRTSQDLVQLNHTYSLPQGSGSLPRPQARDKKPLVATKTASKGASAGNSSSV 1140
            .:..|.     .|||:||..:::.....|..|.    |.:.|.                      
 Worm   283 TTDSSS-----TSPRSSQSSIKIARVVPLTGGQ----RKRGRQ---------------------- 316

  Fly  1141 GGNSSNLEEEHLTRDEKRARSLNIPISVPDIINLPMDEFNERLSKYDLSENQLSLIRDIRRRGKN 1205
                        :.||:.|....:|:|...|..:.:.|..:.|....|:|.|:.|||.|||||||
 Worm   317 ------------SIDEQLASDNGLPVSAFQISEMSLSEVKQVLKDESLNEYQIQLIRKIRRRGKN 369

  Fly  1206 KVAAQNCRKRK 1216
            |.||:.||:|:
 Worm   370 KAAARTCRERR 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cncNP_001262864.1 bZIP_CNC 1192..1259 CDD:269846 17/25 (68%)
coiled coil 1193..1255 CDD:269846 16/24 (67%)
sknr-1NP_001303755.1 bZIP 356..>380 CDD:389750 16/23 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I7815
eggNOG 1 0.900 - - E1_KOG3863
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1095280at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14594
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.