DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnc and nfe2l2b

DIOPT Version :9

Sequence 1:NP_001262864.1 Gene:cnc / 42743 FlyBaseID:FBgn0262975 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_001244112.1 Gene:nfe2l2b / 100873093 ZFINID:ZDB-GENE-120320-3 Length:507 Species:Danio rerio


Alignment Length:275 Identity:100/275 - (36%)
Similarity:140/275 - (50%) Gaps:43/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1056 MGPA---LSKDYHHHQPYGMGASGSAFSGDYTVRPSPRTSQDLVQLNHTYSLPQGSGSLPRPQAR 1117
            |.||   ||:....|...|...|.|..|.|...                 ||.:   ||...|: 
Zfish   262 MAPAQQTLSQFEERHVMLGFDDSASVGSVDLET-----------------SLYE---SLSNEQS- 305

  Fly  1118 DKKPLVA-----TKTASKGASAGNSSSVGGNSSNLEEEHL---TRDEKRARSLNIPISVPDIINL 1174
            ||..|.:     |...|..|.|....:|.......::..:   .|||:||::|::|:||.|||:|
Zfish   306 DKDELESIQSDYTDLLSLSADAMMYETVTNAQEQTQKTRVRRGCRDEQRAQALSLPLSVHDIIHL 370

  Fly  1175 PMDEFNERLSKYDLSENQLSLIRDIRRRGKNKVAAQNCRKRKLDQILTLEDEVNAVVKRKTQLNQ 1239
            |::.|||.:|...|:..|.:||||||||||||:|||:|||||:|.:..||||:..:.::|.|..:
Zfish   371 PVEAFNEAISTCKLNHAQHTLIRDIRRRGKNKMAAQSCRKRKMDSLFGLEDEIEDLKRKKDQCME 435

  Fly  1240 DRDHLESERKRISNKFAMLHRHVFQYLRDPEGNPCSPADYSLQQAADGSVYLLPREKSEGNNTAT 1304
            :::....|......|...|:..||:.|:|..||..:|.:|.||.:.||:||||||.        |
Zfish   436 EKERNARELCETKEKVRKLYNEVFRLLKDEHGNSYNPREYKLQLSTDGTVYLLPRN--------T 492

  Fly  1305 AASNAVSSASGGSLN 1319
            |..|.:||   |.||
Zfish   493 ALKNKMSS---GDLN 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cncNP_001262864.1 bZIP_CNC 1192..1259 CDD:269846 30/66 (45%)
coiled coil 1193..1255 CDD:269846 28/61 (46%)
nfe2l2bNP_001244112.1 bZIP_NFE2-like 388..455 CDD:269868 30/66 (45%)
coiled coil 389..451 CDD:269868 28/61 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3863
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1095280at2759
OrthoFinder 1 1.000 - - FOG0002254
OrthoInspector 1 1.000 - - otm24377
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24411
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.