DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnc and nfe2

DIOPT Version :9

Sequence 1:NP_001262864.1 Gene:cnc / 42743 FlyBaseID:FBgn0262975 Length:1430 Species:Drosophila melanogaster
Sequence 2:XP_012811974.1 Gene:nfe2 / 100170151 XenbaseID:XB-GENE-483914 Length:370 Species:Xenopus tropicalis


Alignment Length:394 Identity:105/394 - (26%)
Similarity:158/394 - (40%) Gaps:115/394 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   923 AGAQGGADRLDASSDSAVSSMGSERVPSLSDGEWGEGSDSAQDYHQGKYGGPYDFSYNNNSRLST 987
            |..||    |||.::|...::|.           |..:..:.||...:|......|.|:|     
 Frog    39 AELQG----LDAQNNSPYDAVGC-----------GTSAMPSSDYGPCQYTEGVAQSLNHN----- 83

  Fly   988 ATRQPPVAQKKHQLY----GKRDPHKQTPSALPPTAPPAAATAVQSQSIKYEYDAGYASSGMASG 1048
                   .|....||    ..:|.|.. |..|.|...|.|.|.:                 :.|.
 Frog    84 -------IQAYDHLYMDTDASQDQHVH-PLPLAPAFGPTAYTGM-----------------LISS 123

  Fly  1049 GISEPGAMGPALSKDYHHHQPYGMGASGSAFSGDYTVRPSPRTSQDLVQLNHTYSLPQGSGSLPR 1113
            .|::.|..|        |:.|..:..:|.     :|....|.     |.|..|.|:        |
 Frog   124 SINQMGITG--------HYPPKNLPVNGL-----FTAHTLPD-----VGLPSTNSV--------R 162

  Fly  1114 PQARDKKPLVATKTASKGASAGNS-------------------SSVGGNS--------------- 1144
            ...:.:..:.:....|...|.|.|                   .::||..               
 Frog   163 QLCKGQDDIESDSGLSLNFSDGESIELENIESQRLQVEYMEMLPTMGGQDQYGIVQHLMHNITDP 227

  Fly  1145 ---SNLEEEHL--TRDEKRARSLNIPISVPDIINLPMDEFNERLSKYDLSENQLSLIRDIRRRGK 1204
               |.|:.|.|  :|||:||.::|||.....|:|||:::|||.||:|.|::.||:|:||||||||
 Frog   228 HQYSALQSEELVCSRDERRAAAMNIPFPTERIVNLPVEDFNELLSRYTLTDTQLALVRDIRRRGK 292

  Fly  1205 NKVAAQNCRKRKLDQILTLEDEVNAVVKRKTQLNQDRDHLESERKRISNKFAMLHRHVFQYLRDP 1269
            ||||||||||||::.|..||.|:..:...:..|.|:::.:....:.:..|...|.:.|...||: 
 Frog   293 NKVAAQNCRKRKMENIAILEREIGQLQTEREGLRQEQEQVGRVMEDLKRKLDGLQQEVLSVLRE- 356

  Fly  1270 EGNP 1273
            :|:|
 Frog   357 KGSP 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cncNP_001262864.1 bZIP_CNC 1192..1259 CDD:269846 30/66 (45%)
coiled coil 1193..1255 CDD:269846 28/61 (46%)
nfe2XP_012811974.1 SMC_prok_B <217..>359 CDD:274008 57/142 (40%)
bZIP_NFE2-like 280..347 CDD:269868 30/66 (45%)
coiled coil 281..343 CDD:269868 28/61 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1095280at2759
OrthoFinder 1 1.000 - - FOG0002254
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24411
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4312
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.