DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13829 and VMA21

DIOPT Version :10

Sequence 1:NP_651129.1 Gene:CG13829 / 42740 FlyBaseID:FBgn0039059 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_011619.3 Gene:VMA21 / 852997 SGDID:S000003337 Length:77 Species:Saccharomyces cerevisiae


Alignment Length:57 Identity:12/57 - (21%)
Similarity:30/57 - (52%) Gaps:5/57 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 MQRLLLFLTVFLLFPVVIFVIFKFLIMEPLYGNSDDNVGIGSGVATVIVMHVLVTGY 104
            :.:|:||....::.||:     .|.|::....|:..:.|:.:.:|.|:::..:|..:
Yeast    10 INKLMLFTAAMVVLPVL-----TFFIIQQFTPNTLISGGLAAAMANVVLIVYIVVAF 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13829NP_651129.1 VMA21 <62..109 CDD:462801 9/43 (21%)
VMA21 138..197 CDD:462801
VMA21NP_011619.3 VMA21 9..61 CDD:462801 12/55 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.