DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13829 and Vma21

DIOPT Version :10

Sequence 1:NP_651129.1 Gene:CG13829 / 42740 FlyBaseID:FBgn0039059 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_006528324.1 Gene:Vma21 / 67048 MGIID:1914298 Length:161 Species:Mus musculus


Alignment Length:58 Identity:17/58 - (29%)
Similarity:29/58 - (50%) Gaps:3/58 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LMSYCSLIIGFPIATFFALKFVVLK-SYAHINAD--IISTICTVVAVHAAVGFYIYRA 196
            |:.:.:|:|..||..:|..|..:.: :....|.|  ..:.|..|||||..:..::|.|
Mouse    90 LLFFTALMITVPIGLYFTTKAYIFEGALGMSNRDSYFYAAIVAVVAVHVVLALFVYVA 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13829NP_651129.1 VMA21 <62..109 CDD:462801
VMA21 138..197 CDD:462801 17/58 (29%)
Vma21XP_006528324.1 VMA21 86..148 CDD:462801 17/58 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.