DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13829 and CG42359

DIOPT Version :10

Sequence 1:NP_651129.1 Gene:CG13829 / 42740 FlyBaseID:FBgn0039059 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_732404.2 Gene:CG42359 / 42299 FlyBaseID:FBgn0259705 Length:132 Species:Drosophila melanogaster


Alignment Length:69 Identity:17/69 - (24%)
Similarity:34/69 - (49%) Gaps:3/69 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 SVFIVLLLMSYCSLIIGFPIATFFALKFVVLKSYAHINADII---STICTVVAVHAAVGFYIYRA 196
            |..:.|.|::|..|:...|...|:.::..:.:|:.|::...:   |.:..||.|:..|..|:.:|
  Fly    39 SAEVFLWLLAYSVLMFTLPFLGFYGVRSWLQESFPHLDLFTVNCWSVLTAVVVVNLVVAMYVLKA 103

  Fly   197 IYAK 200
            ...|
  Fly   104 FREK 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13829NP_651129.1 VMA21 <62..109 CDD:462801
VMA21 138..197 CDD:462801 14/61 (23%)
CG42359NP_732404.2 VMA21 41..>84 CDD:462801 8/42 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.