DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13829 and pdcd-2

DIOPT Version :10

Sequence 1:NP_651129.1 Gene:CG13829 / 42740 FlyBaseID:FBgn0039059 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_497896.1 Gene:pdcd-2 / 259501 WormBaseID:WBGene00011116 Length:386 Species:Caenorhabditis elegans


Alignment Length:40 Identity:11/40 - (27%)
Similarity:19/40 - (47%) Gaps:5/40 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LIFLQEISSMEKLEWEVLMPPNTQIHGSVFIVLLLMSYCS 147
            |.||.::|:    ...:..||:. .|.|:|:.:.....||
 Worm    63 LCFLMQVSA----NGGINDPPHA-FHRSLFLFVCRNPSCS 97

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity