DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13829 and VMA21

DIOPT Version :10

Sequence 1:NP_651129.1 Gene:CG13829 / 42740 FlyBaseID:FBgn0039059 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001350739.1 Gene:VMA21 / 203547 HGNCID:22082 Length:156 Species:Homo sapiens


Alignment Length:68 Identity:14/68 - (20%)
Similarity:32/68 - (47%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KRRAEYLVERMQRLLLFLTVFLLFPVVIFVIFKFLIMEPLYGNSDDNVGIGSGVATVIVMHVLVT 102
            :|....|...::.||.|..:.:..|:.::...|..|.|...|.|:.:....:.:..|:.:||::.
Human    72 RRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMSNRDSYFYAAIVAVVAVHVVLA 136

  Fly   103 GYI 105
            .::
Human   137 LFV 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13829NP_651129.1 VMA21 <62..109 CDD:462801 9/44 (20%)
VMA21 138..197 CDD:462801
VMA21NP_001350739.1 VMA21 80..>122 CDD:462801 9/41 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.