DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13829 and R07E5.7

DIOPT Version :10

Sequence 1:NP_651129.1 Gene:CG13829 / 42740 FlyBaseID:FBgn0039059 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_497898.1 Gene:R07E5.7 / 175577 WormBaseID:WBGene00011115 Length:191 Species:Caenorhabditis elegans


Alignment Length:60 Identity:14/60 - (23%)
Similarity:30/60 - (50%) Gaps:5/60 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 VLLLMSYCSLIIGFPIATFFALKFVVLKSYAHI---NADIISTICT--VVAVHAAVGFYI 193
            :.||:::.:::...|:....:|.:.|...:.|:   .|.:.:.:|.  ||.:.||...||
 Worm   113 ITLLIAFSAMMFTLPLLVMASLYYWVFIDHFHLPPAEAMLYAGVCAALVVILIAAAFCYI 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13829NP_651129.1 VMA21 <62..109 CDD:462801
VMA21 138..197 CDD:462801 14/60 (23%)
R07E5.7NP_497898.1 VMA21 111..174 CDD:462801 14/60 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.