DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unk and AT1G68820

DIOPT Version :10

Sequence 1:NP_001303430.1 Gene:unk / 42738 FlyBaseID:FBgn0004395 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_001323373.1 Gene:AT1G68820 / 843214 AraportID:AT1G68820 Length:474 Species:Arabidopsis thaliana


Alignment Length:71 Identity:25/71 - (35%)
Similarity:40/71 - (56%) Gaps:5/71 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   601 IQKLKQLQSKL--RTDLEEVDKVLY--LENAK-KCMKCEENNRTVTLEPCNHLSICNTCAESVTE 660
            ::::.:||:.|  :||:....:..|  |:|.| .|..|.|:...|.|.||.|..:|:||.|...:
plant   393 VEEIWRLQAALSEQTDITSYSQQEYERLQNEKILCRVCFEDPINVVLLPCRHHVLCSTCCEKCKK 457

  Fly   661 CPYCQV 666
            ||.|:|
plant   458 CPICRV 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unkNP_001303430.1 zf_CCCH_5 21..56 CDD:375810
zf-CCCH 273..299 CDD:459885
COG4372 484..>621 CDD:443500 5/21 (24%)
RING-HC_UNK-like 628..665 CDD:438276 15/37 (41%)
AT1G68820NP_001323373.1 Tmemb_185A 35..291 CDD:402059
zf-C3HC4_3 423..468 CDD:464042 17/41 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.