DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unk and OZF1

DIOPT Version :9

Sequence 1:NP_001303430.1 Gene:unk / 42738 FlyBaseID:FBgn0004395 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_179571.1 Gene:OZF1 / 816500 AraportID:AT2G19810 Length:359 Species:Arabidopsis thaliana


Alignment Length:251 Identity:71/251 - (28%)
Similarity:101/251 - (40%) Gaps:64/251 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 RLCRQGYA-----CPQYH-NSKDKRRSPRKYKYRSTPCPNVKHGEEWGEPGNCEAGDNCQYCHTR 263
            |.|.:|.:     ||..| ..|.:||.|||:.|..|.||..:       .|.|:.||.|::.|..
plant    87 RRCARGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPEFR-------KGCCKRGDACEFSHGV 144

  Fly   264 TEQQFHPEIYKSTKCNDVQQAGYCPRSVFCAFAHVEPCSIDEKTRDHTVYLNELISNAYPDLKAQ 328
            .|...||..|::..|.|   .|.|.|.| |.||| .|..|            .::.|..||    
plant   145 FECWLHPARYRTQPCKD---GGNCRRRV-CFFAH-SPDQI------------RVLPNQSPD---- 188

  Fly   329 DAFQRVDNLLNIDGNSTNKMLVDALENTTNFSKFLSFSRPL-----DSRSACSMDDPRENSLSAS 388
                |||:.         .:|...:.....||...|.:.|.     ||.|:||:   ...||.::
plant   189 ----RVDSF---------DVLSPTIRRAFQFSISPSSNSPPVSPRGDSDSSCSL---LSRSLGSN 237

  Fly   389 LANTSLLTRSSAPINIPNTTLSNSIND--------FNSGSFAVNIPS-SSLTYSPT 435
            |.|..:.:..:..:|...::||:|.|:        |.|...:|..|. .||..:||
plant   238 LGNDVVASLRNLQLNKVKSSLSSSYNNQIGGYGSGFGSPRGSVLGPGFRSLPTTPT 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unkNP_001303430.1 zf-CCCH 273..299 CDD:279036 11/25 (44%)
FhaB <311..548 CDD:225751 33/139 (24%)
zf-C3HC4_3 626..671 CDD:290631
OZF1NP_179571.1 ZnF_C3H1 119..143 CDD:214632 9/30 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1595
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2630
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14493
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.