DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hh and grd-9

DIOPT Version :9

Sequence 1:NP_001034065.1 Gene:hh / 42737 FlyBaseID:FBgn0004644 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_504535.2 Gene:grd-9 / 191663 WormBaseID:WBGene00001698 Length:588 Species:Caenorhabditis elegans


Alignment Length:293 Identity:54/293 - (18%)
Similarity:89/293 - (30%) Gaps:96/293 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GLGRHRARNLY--------------------PLVLKQTIPNLSEYTNSASGPLEGVIRRDSPKFK 134
            |:..:|:||.|                    .:..|.:..:.||....|........|:...|.|
 Worm   253 GVNNYRSRNSYGTNNRKHGRNGKKGKSSKMCKMCRKLSEEDESEEKEMACDLCSKSRRKGKKKGK 317

  Fly   135 DLVPNYNRDILFRDEEGTGADRLMSKRCKEKLNVLAYSVMNEWPGIRLLVTESWDEDYHHGQESL 199
            .|            .:|....|..|.:..|..:....|:..|..|     ||::..|..:|.:..
 Worm   318 SL------------RDGMVGGRRKSSKSSEDSDDHDDSMEGEGGG-----TENFTNDDENGADDY 365

  Fly   200 HYEGRAVTIATS-------------DRDQSKYGMLARL-----------------AVEAGFDWVS 234
            ..:|.:.||..:             .:.|:|   |.|:                 |.|.|.|   
 Worm   366 EDDGESTTIKPNAVSQPTILDFVERSKQQNK---LMRIPVYRGKKLEAESNGTSGAYEDGDD--- 424

  Fly   235 YVSRRHIYCSVKSDSSISSHVHG---------------CFTPESTALLESGVRKPLGELSIGDRV 284
              :..|.....:..|..||::..               .:.|:.|..|::....|.|.:...   
 Worm   425 --NGEHNREEEEESSQYSSNIRDMEQPTKYSSKPNVKYSYPPKDTLPLQTCFHNPSGYVCCN--- 484

  Fly   285 LSMTANGQAVYSEV---ILFMDRNLEQMQNFVQ 314
            |.:....::.|.||   ..|...||:.:.|.||
 Worm   485 LELNNVVESTYKEVRELPNFNPCNLQLIANKVQ 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hhNP_001034065.1 HH_signal 99..243 CDD:279432 32/193 (17%)
Hint 254..465 CDD:279426 15/79 (19%)
Hint 258..400 CDD:238035 15/60 (25%)
grd-9NP_504535.2 Ground-like 479..561 CDD:367846 11/42 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156252
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.