powered by:
Protein Alignment hh and wrt-9
DIOPT Version :9
Sequence 1: | NP_001034065.1 |
Gene: | hh / 42737 |
FlyBaseID: | FBgn0004644 |
Length: | 471 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_508298.2 |
Gene: | wrt-9 / 181931 |
WormBaseID: | WBGene00006955 |
Length: | 553 |
Species: | Caenorhabditis elegans |
Alignment Length: | 63 |
Identity: | 16/63 - (25%) |
Similarity: | 22/63 - (34%) |
Gaps: | 21/63 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 PMVFSPAHSCGPGRGLGRHRARNLYPLVLKQTIPNLSEYTNSASGPLEGVIRRDSPKFKDLVP 138
|.||:|.... |..||.: |||.::....:.|..|| |:...|.|
Worm 353 PFVFAPLPPF-PQFGLPQ---------------PNLFQFPAPPAPPPFGV-----PQAPQLAP 394
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3638 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.