DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hh and wrt-4

DIOPT Version :9

Sequence 1:NP_001034065.1 Gene:hh / 42737 FlyBaseID:FBgn0004644 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_510593.1 Gene:wrt-4 / 181664 WormBaseID:WBGene00006950 Length:557 Species:Caenorhabditis elegans


Alignment Length:226 Identity:55/226 - (24%)
Similarity:106/226 - (46%) Gaps:36/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 CFTPESTALLESGVRKPLGELSIGDRVLSMTANG-QAVYSEVILFMDRNLEQMQNFVQLHTDGGA 321
            ||..::...:.:|..|.:.||::||.|.::..|| |..:..|..::.|:.:|:.:||:...|.|.
 Worm   346 CFPGDAMVNVYNGGFKRMDELAVGDWVQALDKNGSQVTFIPVQYWLHRDPKQVADFVEFTLDNGE 410

  Fly   322 VLTVTPAHLVSVWQ---PESQKLTF----VFADRI----------EEKNQVLVRDVETGELRPQR 369
            ..::|..|||.|.|   |.|:....    |.|:|:          .:|:|:..|         .:
 Worm   411 TFSLTEKHLVFVTQCSVPYSEDENINANPVPAERVNIGDCFYIAHRKKSQMYQR---------VK 466

  Fly   370 VVKVGSVRSKGVVAPLTREGTIVVNSVAASCYAVINSQSLAHWGLAPMRLLSTLEAWLPAKEQLH 434
            |:.:..|:..|:.:|:|..|.::|:.:.|||::..::.||.:      ...:.:..|   |.|:.
 Worm   467 VLDINIVQKTGIYSPMTSRGHLLVDRIHASCHSETDNYSLQN------TFFTNVLRW---KSQIR 522

  Fly   435 SSPKVVSSAQQQNGIHWYANALYKVKDYVLP 465
            :....|..:..::.|.:..|.:..|.|.|:|
 Worm   523 NYFWTVEDSTNEDNIGYGLNGVMAVLDIVIP 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hhNP_001034065.1 HH_signal 99..243 CDD:279432
Hint 254..465 CDD:279426 54/224 (24%)
Hint 258..400 CDD:238035 41/159 (26%)
wrt-4NP_510593.1 Hint 342..547 CDD:279426 51/218 (23%)
Hint 346..497 CDD:238035 41/159 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156258
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.704428 Normalized mean entropy S4101
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1169356at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14084
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.700

Return to query results.
Submit another query.