DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hh and wrt-3

DIOPT Version :9

Sequence 1:NP_001034065.1 Gene:hh / 42737 FlyBaseID:FBgn0004644 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001379102.1 Gene:wrt-3 / 177781 WormBaseID:WBGene00006949 Length:179 Species:Caenorhabditis elegans


Alignment Length:168 Identity:34/168 - (20%)
Similarity:60/168 - (35%) Gaps:39/168 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VALLLIVLPMVFSPAHSCGPGR---GLGRHRARNLYPLVLKQTIPNLSEYTNSASGPLEGVIRRD 129
            |.:..|:|...||.|..||..:   |:..|.:..:..:..|   ||..: .|.:..|.....|..
 Worm     5 VEMFTIILLFGFSLADYCGSDQVPYGMEVHHSGVVRLMCSK---PNCYD-KNYSDCPERAESRHG 65

  Fly   130 SPKFKDLVPNYNRDILFRDEEGTGADRLMSKRCK----EKLNVLAYSVMNEWPGIRLLVTESWDE 190
            ..|....|..:.::|     ||.    |.:..|:    ||...:.||.:....|           
 Worm    66 CQKSNQWVGGFEKNI-----EGD----LYTMCCEFEGLEKYAKVRYSDVRIRRG----------- 110

  Fly   191 DYHHGQESLHYEG--------RAVTIATSDRDQSKYGM 220
            ::..|:|..:.:|        :.:.:...|..|:.|.:
 Worm   111 EFFEGEEKENDDGDVVKFDVIKDIRMHKDDEGQAYYNL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hhNP_001034065.1 HH_signal 99..243 CDD:279432 24/134 (18%)
Hint 254..465 CDD:279426
Hint 258..400 CDD:238035
wrt-3NP_001379102.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156255
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.