DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hh and wrt-5

DIOPT Version :10

Sequence 1:NP_001034065.1 Gene:hh / 42737 FlyBaseID:FBgn0004644 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001040994.1 Gene:wrt-5 / 177162 WormBaseID:WBGene00006951 Length:176 Species:Caenorhabditis elegans


Alignment Length:72 Identity:16/72 - (22%)
Similarity:23/72 - (31%) Gaps:29/72 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 CKEKLNVLAYSVMNEWPG---------IRLLVTESWD-----------------EDYHHGQESLH 200
            |.|:......|..:.|.|         :||:..| :|                 .:|..|.|.: 
 Worm    58 CPERATSTTCSTNSSWVGGVTQHSDGSLRLMCCE-YDLLPTYSTIQYEKLTIRTGEYFEGDEQM- 120

  Fly   201 YEGRAVT 207
             ||..||
 Worm   121 -EGDVVT 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hhNP_001034065.1 HH_signal 85..243 CDD:460055 16/72 (22%)
Hint 254..465 CDD:460051
wrt-5NP_001040994.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.