DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hh and grd-3

DIOPT Version :10

Sequence 1:NP_001034065.1 Gene:hh / 42737 FlyBaseID:FBgn0004644 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_500346.2 Gene:grd-3 / 177109 WormBaseID:WBGene00001692 Length:181 Species:Caenorhabditis elegans


Alignment Length:39 Identity:11/39 - (28%)
Similarity:20/39 - (51%) Gaps:7/39 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 RHRARNLYPLVLKQTIPNLSEY-------TNSASGPLEG 124
            |.:..|.:.|..|..:|::|::       .|:|:|.|.|
 Worm   127 REKYFNKFALNDKLRLPSVSKHLKQFSGLANTATGGLSG 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hhNP_001034065.1 HH_signal 85..243 CDD:460055 11/39 (28%)
Hint 254..465 CDD:460051
grd-3NP_500346.2 Ground-like 36..115 CDD:461200
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.