DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hh and qua-1

DIOPT Version :9

Sequence 1:NP_001034065.1 Gene:hh / 42737 FlyBaseID:FBgn0004644 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_495725.2 Gene:qua-1 / 174319 WormBaseID:WBGene00004264 Length:1169 Species:Caenorhabditis elegans


Alignment Length:167 Identity:51/167 - (30%)
Similarity:88/167 - (52%) Gaps:16/167 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 CFTPESTALLESGVRKPLGELSIGDRVLSMTANGQAVYSEVILFMDRNLEQMQNFVQLHTDGGAV 322
            ||:.:|.....:| :|.:.||.|||.||..::.....|.:|.:|..|..:...|||.|:|..|..
 Worm   961 CFSADSLVTTVTG-QKRMDELQIGDYVLVPSSGNVLKYEKVEMFYHREPKTRTNFVVLYTKSGRK 1024

  Fly   323 LTVTPAHLVSV----------WQPESQKLTF---VFADRIEEKNQVLVRDVETGELRPQRVVKVG 374
            |::|..||:.|          ..|:...:..   .:|::..:...||..| |:||:....:|:||
 Worm  1025 LSLTGRHLLPVAECSQVEQYTMNPDGIDVAMRESKYAEKARKGECVLSID-ESGEVIADEIVRVG 1088

  Fly   375 SVRSKGVVAPLTREGTIVVNSVAASCYAVINSQSLAH 411
            .:.:.|:.:|:|.||:::|:.|.:||::.:.|.| ||
 Worm  1089 RMTNVGIYSPMTVEGSLIVDGVLSSCFSHLESHS-AH 1124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hhNP_001034065.1 HH_signal 99..243 CDD:279432
Hint 254..465 CDD:279426 51/167 (31%)
Hint 258..400 CDD:238035 45/154 (29%)
qua-1NP_495725.2 Hint 961..1114 CDD:238035 45/154 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I5947
eggNOG 1 0.900 - - E1_KOG3638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.704428 Normalized mean entropy S4101
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14084
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.720

Return to query results.
Submit another query.