DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hh and wrt-1

DIOPT Version :9

Sequence 1:NP_001034065.1 Gene:hh / 42737 FlyBaseID:FBgn0004644 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_495579.3 Gene:wrt-1 / 174223 WormBaseID:WBGene00006947 Length:484 Species:Caenorhabditis elegans


Alignment Length:352 Identity:84/352 - (23%)
Similarity:145/352 - (41%) Gaps:92/352 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 YNRDILFRDEEGTGADRLMSKRCKEKL----NVLAYSV----MNEWPGIRLLVTESWDEDYHHGQ 196
            |:...:.||...||.|.:.:.|   |:    ..:||.|    ||..|              :.|:
 Worm   152 YSGGEVLRDGRQTGFDAISNVR---KITSGDGTVAYEVTVTRMNCLP--------------NPGE 199

  Fly   197 ESLHYEGRAVTIATSDRDQSKYGMLARLAVEAGFDWVSYVSRRHIYC--------SVKSDSSIS- 252
            ||     ..|:. ...||      :.|:..:.|....|.|...||..        .|:|||.:| 
 Worm   200 ES-----NEVSF-DIQRD------IGRILDKVGETAASGVQTNHIEADQRLSPSTDVQSDSYVSP 252

  Fly   253 --------------------------------SHVHGCFTPESTALLESGVRKPLGELSIGDRVL 285
                                            |.|..|||..|..:..:| .|.:.:||:||.|:
 Worm   253 TEADPQEPVEQFVQVGEQVVPVTSAGYYYPVASGVPACFTGNSKVMTPAG-EKSMADLSVGDMVM 316

  Fly   286 SMTANGQAVYSEVILFMDRNLEQMQNFVQLHTDGGAVLTVTPAHLVSVWQPESQKLTFVFADRIE 350
            :. ..|:..|:.|..::.|..:....|::|.|:.||::.:||.|.:......::::..|:|:.:.
 Worm   317 TY-EYGKMTYTRVASWLHRLPDTKAAFIKLTTEQGAIIDMTPQHFIYKANCVTEEMELVYAEDMT 380

  Fly   351 EKNQVLVRDVETGELRPQRVVKVGSVRSKGVVAPLTREGTIVVNSVAASCYAVINSQSLAHWGL- 414
            ..:.::|::.|  :|....:.:..:....||.||:|..|.::|:.|.|||:.|:.:.:|:|..| 
 Worm   381 IGDCLMVKENE--KLVMTTISEKSTFYETGVYAPMTETGDLIVDDVYASCHNVVKANTLSHTFLN 443

  Fly   415 ------APMR-LLSTLE--AWLPAKEQ 432
                  ..|| :|.:||  ..|||..:
 Worm   444 FATSVQQKMRSVLGSLEETGHLPATSE 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hhNP_001034065.1 HH_signal 99..243 CDD:279432 26/110 (24%)
Hint 254..465 CDD:279426 52/189 (28%)
Hint 258..400 CDD:238035 37/141 (26%)
wrt-1NP_495579.3 Hint 290..428 CDD:238035 37/141 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1169356at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14084
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.