DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and ZBTB24

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_055612.2 Gene:ZBTB24 / 9841 HGNCID:21143 Length:697 Species:Homo sapiens


Alignment Length:355 Identity:92/355 - (25%)
Similarity:146/355 - (41%) Gaps:87/355 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 EIYIINSASSEDQNQDSTPEFDQDNG-----ITSYNIKEDGEIQFSGEKPEEI----EDVVVFNL 385
            ::|.:..|.::.||..|:|:....|.     :...|.|.|...:..| :|:::    |:......
Human   117 KVYDLVKAYTDFQNNHSSPKPTTLNTAGAPVVVISNKKNDPPKRKRG-RPKKVNTLQEEKSELAA 180

  Fly   386 GEEIS-------QEQQVF-------SFHENVIIVEKEQND------RDEQTPLKRKRSSELVFKQ 430
            .|||.       |.:|.|       ..:|.:...|||:::      |:|:.|::         |.
Human   181 EEEIQLRVNNSVQNRQNFVVKGDSGVLNEQIAAKEKEESEPTCEPSREEEMPVE---------KD 236

  Fly   431 ESSCPQPKTG----------RITDTVK-----------------------------SFQCHLCPV 456
            |:..|:.:.|          ||..:||                             ..:|..|..
Human   237 ENYDPKTEDGQASQSRYSKRRIWRSVKLKDYKLVGDQEDHGSAKRICGRRKRPGGPEARCKDCGK 301

  Fly   457 AFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFS 521
            .|.....|..|..:|     :|: ...||..|....:...||:.|..:|||.:|:.|:.|..:.:
Human   302 VFKYNHFLAIHQRSH-----TGE-RPFKCNECGKGFAQKHSLQVHTRMHTGERPYTCTVCSKALT 360

  Fly   522 QREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSR 586
            .:..|..||..|:|.|...|.||...|:|...|:.|. |||.|:| ..:|..|||.|..||.|.:
Human   361 TKHSLLEHMSLHSGQKSFTCDQCGKYFSQNRQLKSHY-RVHTGHS-LPECKDCHRKFMDVSQLKK 423

  Fly   587 HLVTHAGVM-FSCKQCGRQFNDRSAVQRHV 615
            ||.||.|.. |:|:.||:.|..:|::|.|:
Human   424 HLRTHTGEKPFTCEICGKSFTAKSSLQTHI 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 19/75 (25%)
C2H2 Zn finger 485..505 CDD:275368 5/19 (26%)
zf-H2C2_2 497..522 CDD:290200 9/24 (38%)
C2H2 Zn finger 513..533 CDD:275368 5/19 (26%)
zf-H2C2_2 526..550 CDD:290200 10/23 (43%)
C2H2 Zn finger 541..562 CDD:275368 8/20 (40%)
C2H2 Zn finger 571..591 CDD:275368 10/19 (53%)
C2H2 Zn finger 598..617 CDD:275368 7/18 (39%)
ZBTB24NP_055612.2 BTB 27..133 CDD:306997 4/15 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..176 9/45 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..254 11/53 (21%)
C2H2 Zn finger 296..316 CDD:275368 5/19 (26%)
COG5048 <321..480 CDD:227381 51/135 (38%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
C2H2 Zn finger 352..372 CDD:275368 5/19 (26%)
C2H2 Zn finger 380..400 CDD:275368 8/20 (40%)
C2H2 Zn finger 408..428 CDD:275368 10/19 (53%)
C2H2 Zn finger 436..456 CDD:275368 7/18 (39%)
C2H2 Zn finger 464..480 CDD:275368
C2H2 Zn finger 492..512 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 652..697
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.