DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and ZNF341

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001269862.1 Gene:ZNF341 / 84905 HGNCID:15992 Length:854 Species:Homo sapiens


Alignment Length:365 Identity:92/365 - (25%)
Similarity:147/365 - (40%) Gaps:87/365 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 EIYIINSASSEDQNQDST------PEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVV------ 382
            ::..:|.:..||  ::||      |...|...:::...:|       |:|||..:.|::      
Human   392 QVMALNPSRQED--EESTGLGQPLPGAPQPQALSTAGEEE-------GDKPESKQVVLIDSSYLC 447

  Fly   383 ----------FNLGEEISQ--EQQVF---------------SFHENVIIVEKEQNDR-------- 412
                      |.|...::|  .:||:               :|.|::...::|.:.|        
Human   448 QFCPSKFSTYFQLKSHMTQHKNEQVYKCVVKSCAQTFPKLDTFLEHIKSHQEELSYRCHLCGKDF 512

  Fly   413 ------------DEQTPLKRKRSSELVFK-----QESSCPQPKTGRITDTVKSFQCHLCPVAFPT 460
                        ....|....:....|:|     .:.|.|:.....:.....:|.|..|...||.
Human   513 PSLYDLGVHQYSHSLLPQHSPKKDNAVYKCVKCVNKYSTPEALEHHLQTATHNFPCPHCQKVFPC 577

  Fly   461 QKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREV 525
            ::.|.||..||      |.||..||..|.........||.|..||:|.||:|||.||.:|::::.
Human   578 ERYLRRHLPTH------GSGGRFKCQVCKKFFRREHYLKLHAHIHSGEKPYKCSVCESAFNRKDK 636

  Fly   526 LKRHMDTHTGVKRHQCP-----QCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLS 585
            |||||..|...|:::||     .||..|.:...|:.|| ..|.| .:.|||.||.:||:..:.|:
Human   637 LKRHMLIHEPFKKYKCPFSTHTGCSKEFNRPDKLKAHI-LSHSG-MKLHKCALCSKSFSRRAHLA 699

  Fly   586 RHLVTHAG-VMFSCKQCGRQFNDRSAVQRHVTTMHKVKNK 624
            .|...|.| ..|.|..|.:.|:....::.|...:...|:|
Human   700 EHQRAHTGNYKFRCAGCAKGFSRHKYLKDHRCRLGPQKDK 739

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 31/75 (41%)
C2H2 Zn finger 485..505 CDD:275368 5/19 (26%)
zf-H2C2_2 497..522 CDD:290200 14/24 (58%)
C2H2 Zn finger 513..533 CDD:275368 10/19 (53%)
zf-H2C2_2 526..550 CDD:290200 12/28 (43%)
C2H2 Zn finger 541..562 CDD:275368 8/25 (32%)
C2H2 Zn finger 571..591 CDD:275368 7/19 (37%)
C2H2 Zn finger 598..617 CDD:275368 4/18 (22%)
ZNF341NP_001269862.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..217
COG5048 323..729 CDD:227381 89/353 (25%)
C2H2 Zn finger 324..344 CDD:275368
C2H2 Zn finger 352..372 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..434 9/43 (21%)
C2H2 Zn finger 447..467 CDD:275368 2/19 (11%)
C2H2 Zn finger 475..497 CDD:275368 2/21 (10%)
C2H2 Zn finger 505..525 CDD:275368 0/19 (0%)
C2H2 Zn finger 542..562 CDD:275370 2/19 (11%)
C2H2 Zn finger 568..588 CDD:275368 7/19 (37%)
C2H2 Zn finger 596..616 CDD:275368 5/19 (26%)
C2H2 Zn finger 624..644 CDD:275368 10/19 (53%)
C2H2 Zn finger 652..677 CDD:275368 8/25 (32%)
C2H2 Zn finger 685..705 CDD:275368 7/19 (37%)
C2H2 Zn finger 713..730 CDD:275368 3/16 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 731..763 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4907
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.