DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and TT1

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_174737.2 Gene:TT1 / 840386 AraportID:AT1G34790 Length:303 Species:Arabidopsis thaliana


Alignment Length:310 Identity:72/310 - (23%)
Similarity:109/310 - (35%) Gaps:94/310 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 IYIINSASSED------QNQDSTPEFDQDNGITS-----------YNIKEDGEIQ------FSGE 372
            :|.|:|:||.:      |:.|..|..:|::.|.:           .|:..:.::.      ..||
plant     6 LYEISSSSSSEKPRHHFQSLDLFPNLNQNSCINNTLIEPLPLIDRINLNSNLDLNPNPLYAEEGE 70

  Fly   373 KPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELV-------FKQ 430
            :.||.|        ||..:|..| ..|..:....|..||..:   ||::...|:.       .:.
plant    71 QEEEEE--------EEEDREVDV-DLHIGLPGFGKPSNDAKQ---LKKRNGKEIATYDAGKGIEN 123

  Fly   431 ESS-----CPQPKTGRITDTVKSFQCHLCPVAFPT-------QKLLTRHHNTHIKGLKSGKGGTL 483
            |.|     .|.|:  :|......|.||:|   |.|       |..:..|.:.:.||.:|.||.. 
plant   124 ELSGKAYWIPAPE--QILIGFTHFSCHVC---FKTFNRYNNLQMHMWGHGSQYRKGPESLKGTQ- 182

  Fly   484 KCPSCALQLSCASSLK--RHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSS 546
              |...|.:.|...::  |:.|.|...||.|         ....|:.|.....|.|...|..|..
plant   183 --PRAMLGIPCYCCVEGCRNHIDHPRSKPLK---------DFRTLQTHYKRKHGHKPFSCRLCGK 236

  Fly   547 CFAQKSNLQQHIGRVHMGNSRTHK--------CHLCHRSFNHVSGLSRHL 588
            ..|.|            |:.|||:        | :|...|.|...|..|:
plant   237 LLAVK------------GDWRTHEKNCGKRWVC-VCGSDFKHKRSLKDHV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 20/84 (24%)
C2H2 Zn finger 485..505 CDD:275368 5/21 (24%)
zf-H2C2_2 497..522 CDD:290200 6/26 (23%)
C2H2 Zn finger 513..533 CDD:275368 2/19 (11%)
zf-H2C2_2 526..550 CDD:290200 6/23 (26%)
C2H2 Zn finger 541..562 CDD:275368 4/20 (20%)
C2H2 Zn finger 571..591 CDD:275368 6/18 (33%)
C2H2 Zn finger 598..617 CDD:275368
TT1NP_174737.2 C2H2 Zn finger 231..247 CDD:275368 6/27 (22%)
C2H2 Zn finger 257..274 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.