DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and DOT5

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_172787.1 Gene:DOT5 / 837889 AraportID:AT1G13290 Length:302 Species:Arabidopsis thaliana


Alignment Length:274 Identity:64/274 - (23%)
Similarity:95/274 - (34%) Gaps:73/274 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 YNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRS 423
            ||   :.:..|||:     ||.||.:||    ...|.:..| |.....|..:|.:...||.....
plant     2 YN---NNQYSFSGD-----EDSVVLSLG----PPGQQYPSH-NKPTSTKPSSDHEFNHPLTNPNG 53

  Fly   424 SELVF----------------KQESSCPQ------PKTGRITDTVKSFQCHLCPVAF----PTQK 462
            ..:..                .||....:      |...:|......|.|.:|...|    ..|.
plant    54 VTVALHIGPPSSDKETLSGGNNQEGLTARQGQYWIPSLSQILVGPTQFSCSVCNKTFNRFNNMQM 118

  Fly   463 LLTRHHNTHIKGLKSGKGGTLKCPSCALQLSC---------------ASSLKRHMIIHT------ 506
            .:..|.:.:.||.:|.:|  .|..|..|:|.|               :..||....:.|      
plant   119 HMWGHGSQYRKGPESLRG--TKSSSSILRLPCYCCAEGCKNNIDHPRSKPLKDFRTLQTHYKRKH 181

  Fly   507 GLKPFKC-SECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHK 570
            |.|||:| .:||.:|:.|...:.| :.:.| |...| .|.|.|..|.:|:.|:.....|      
plant   182 GAKPFRCRKKCEKTFAVRGDWRTH-EKNCG-KLWFC-VCGSDFKHKRSLKDHVRAFGDG------ 237

  Fly   571 CHLCHRSFNHVSGL 584
             |..|...:.|.|:
plant   238 -HAAHTVSDRVVGI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 25/101 (25%)
C2H2 Zn finger 485..505 CDD:275368 6/34 (18%)
zf-H2C2_2 497..522 CDD:290200 11/31 (35%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 7/23 (30%)
C2H2 Zn finger 541..562 CDD:275368 7/20 (35%)
C2H2 Zn finger 571..591 CDD:275368 4/14 (29%)
C2H2 Zn finger 598..617 CDD:275368
DOT5NP_172787.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.