DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and ZBTB14

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001137295.1 Gene:ZBTB14 / 7541 HGNCID:12860 Length:449 Species:Homo sapiens


Alignment Length:571 Identity:132/571 - (23%)
Similarity:206/571 - (36%) Gaps:172/571 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 SRVFSKDPDDY--------DEDELEFE-DSIAFIEVQDKVRKLEDEKWREDFKEEQAAEMHKRLV 152
            |.....:.||:        :|..||.| ..||.:        :||.|:|.......|...:.:.:
Human     8 SETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIV--------VEDVKFRAHRCVLAACSTYFKKL 64

  Fly   153 KSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVSEDIRKEQLAMLLGE-LEV 216
            ..:||:.:....|:         ..:|.::.|||.:.:.....:...||:   .|.|..|: |.:
Human    65 FKKLEVDSSSVIEI---------DFLRSDIFEEVLNYMYTAKISVKKEDV---NLMMSSGQILGI 117

  Fly   217 YLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFI 281
            ...:|...  :..|.|.|        |.:..:||:|...|....:.|    |.:.:.|..||   
Human   118 RFLDKLCS--QKRDVSSP--------DENNGQSKSKYCLKINRPIGD----AADTQDDDVEE--- 165

  Fly   282 LGCNTDPANNSDVNIDG--------------LELDEEVPAESG-EDFREINMVGSDVVHTDNGEI 331
            :|...|  :.||..::|              |.:.|.:..|.| |:.|::|..|.:|...:    
Human   166 IGDQDD--SPSDDTVEGTPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESME---- 224

  Fly   332 YIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVF 396
                           ||| .:|.|                                  ||..|..
Human   225 ---------------TPE-SKDLG----------------------------------SQTPQAL 239

  Fly   397 SFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQ 461
            :|::.:..|      :|||||.....:|::.|                                :
Human   240 TFNDGMSEV------KDEQTPGWTTAASDMKF--------------------------------E 266

  Fly   462 KLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVL 526
            .||..||...|           .|.:|....|....|::|..:||..:||.|..|...|:.:..|
Human   267 YLLYGHHREQI-----------ACQACGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQAHL 320

  Fly   527 KRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTH 591
            |.|:..|||.|.:.|..|...|.:..:|::| .||| .|.|...||:|.::|.|.|.|..|...|
Human   321 KEHLKIHTGYKPYSCEVCGKSFIRAPDLKKH-ERVH-SNERPFACHMCDKAFKHKSHLKDHERRH 383

  Fly   592 AGVM-FSCKQCGRQFNDRSAVQRHVTTMHKVKNKLTDYI--SETNEFQAVA 639
            .|.. |.|..|.:.|...|.::||...||..:.::|...  |||.:.||.|
Human   384 RGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTPSAIQSETEQLQAAA 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 28/136 (21%)
RRF <161..222 CDD:294170 11/61 (18%)
zf-C2H2_8 454..530 CDD:292531 19/75 (25%)
C2H2 Zn finger 485..505 CDD:275368 5/19 (26%)
zf-H2C2_2 497..522 CDD:290200 9/24 (38%)
C2H2 Zn finger 513..533 CDD:275368 6/19 (32%)
zf-H2C2_2 526..550 CDD:290200 10/23 (43%)
C2H2 Zn finger 541..562 CDD:275368 6/20 (30%)
C2H2 Zn finger 571..591 CDD:275368 8/19 (42%)
C2H2 Zn finger 598..617 CDD:275368 6/18 (33%)
ZBTB14NP_001137295.1 BTB_POZ_ZBTB14 18..131 CDD:349513 26/134 (19%)
Nuclear localization signal. /evidence=ECO:0000255 50..66 1/15 (7%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..194 10/49 (20%)
C2H2 Zn finger 279..299 CDD:275368 5/19 (26%)
SFP1 <303..383 CDD:227516 30/81 (37%)
C2H2 Zn finger 307..327 CDD:275368 6/19 (32%)
zf-H2C2_2 319..344 CDD:404364 10/24 (42%)
C2H2 Zn finger 335..355 CDD:275368 6/20 (30%)
C2H2 Zn finger 363..383 CDD:275368 8/19 (42%)
C2H2 Zn finger 391..407 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.