DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and GZF1

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001303941.1 Gene:GZF1 / 64412 HGNCID:15808 Length:711 Species:Homo sapiens


Alignment Length:618 Identity:150/618 - (24%)
Similarity:235/618 - (38%) Gaps:159/618 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 YQ-LEKSFLFRQRCQWAEKKLRKHIRLLGL---GKRSRVFSKDPDDYDEDELEFEDSIAFIE--V 123
            || :.|.|:..:....|..|..|.:.|...   |.|:.|:.        :|::..|..:|:|  .
Human    39 YQGVRKDFMAHKAVLAATSKFFKEVFLNEKSVDGTRTNVYL--------NEVQVADFASFLEFVY 95

  Fly   124 QDKVRKLEDEKWREDFKEEQAAEMHKRLVKSRLELRAKLTT--------ELRKELAEEVRSEVRK 180
            ..||:..||.                  |:..||:..||..        :|:|::.|.|..|::.
Human    96 TAKVQVEEDR------------------VQRMLEVAEKLKCLDLSETCFQLKKQMLESVLLELQN 142

  Fly   181 -ELAEEVRSQVRDDLRNEVSEDIRKEQLAMLLGELEVYLTE--KKAGRWESLDGSEPETKPQVKE 242
             ..::||          |||..   .|::..........|:  ..:|..:|||.........:..
Human   143 FSESQEV----------EVSSG---SQVSAAPAPRASVATDGPHPSGLTDSLDYPGERASNGMSS 194

  Fly   243 DASPSRSKTKALPKRR-------PSL--VDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDG 298
            |..|.:||.| |.|::       |.:  ....|...:...:..::::     |..........:|
Human   195 DLPPKKSKDK-LDKKKEVVKPPYPKIRRASGRLAGRKVFVEIPKKKY-----TRRLREQQKTAEG 253

  Fly   299 LELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKE 363
            ...|...|.:...|     .||:::......| .....|..|:.::.:.||              
Human   254 DVGDYRCPQDQSPD-----RVGTEMEQVSKNE-GCQAGAELEELSKKAGPE-------------- 298

  Fly   364 DGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVF--SFHENVIIVEKEQNDRDEQTPLKRKR---- 422
                   .|:.||.||       ||..:::..|  |..|...:.||        :.||..:    
Human   299 -------EEEEEEEED-------EEGEKKKSNFKCSICEKAFLYEK--------SFLKHSKHRHG 341

  Fly   423 -SSELVFKQESSCPQPKTGR---------ITDTVKSFQCHLCPVAFPTQKLLTRH----H----N 469
             ::|:|::.: :|.|....|         :..:.:.|.|.||...|..:|.:.||    |    .
Human   342 VATEVVYRCD-TCGQTFANRCNLKSHQRHVHSSERHFPCELCGKKFKRKKDVKRHVLQVHEGGGE 405

  Fly   470 THIKGLKSGKGGTLK-----------------CPSCALQLSCASSLKRHMIIHTGLKPFKCSECE 517
            .|..| :.|||.:.|                 |..|..:.|..|:||.||.||||.|||.|.||.
Human   406 RHRCG-QCGKGLSSKTALRLHERTHTGDRPYGCTECGARFSQPSALKTHMRIHTGEKPFVCDECG 469

  Fly   518 LSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVS 582
            ..|:|..:|..|...|||.:...|..|...||.|..|:.| .|:|.| |:..||.:|.|:|...:
Human   470 ARFTQNHMLIYHKRCHTGERPFMCETCGKSFASKEYLKHH-NRIHTG-SKPFKCEVCFRTFAQRN 532

  Fly   583 GLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRH 614
            .|.:|:..|.|.. :.|.|||:||...:|:|||
Human   533 SLYQHIKVHTGERPYCCDQCGKQFTQLNALQRH 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 6/21 (29%)
vATP-synt_E 109..>244 CDD:304907 29/147 (20%)
RRF <161..222 CDD:294170 14/71 (20%)
zf-C2H2_8 454..530 CDD:292531 33/100 (33%)
C2H2 Zn finger 485..505 CDD:275368 8/19 (42%)
zf-H2C2_2 497..522 CDD:290200 15/24 (63%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
zf-H2C2_2 526..550 CDD:290200 8/23 (35%)
C2H2 Zn finger 541..562 CDD:275368 8/20 (40%)
C2H2 Zn finger 571..591 CDD:275368 6/19 (32%)
C2H2 Zn finger 598..617 CDD:275368 10/17 (59%)
GZF1NP_001303941.1 BTB 21..133 CDD:306997 26/119 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..220 14/70 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..312 18/102 (18%)
C2H2 Zn finger 319..339 CDD:275368 6/27 (22%)
C2H2 Zn finger 350..371 CDD:275368 3/21 (14%)
COG5048 <405..593 CDD:227381 61/164 (37%)
C2H2 Zn finger 409..429 CDD:275368 5/20 (25%)
C2H2 Zn finger 437..457 CDD:275368 8/19 (42%)
C2H2 Zn finger 465..485 CDD:275368 7/19 (37%)
C2H2 Zn finger 493..513 CDD:275368 8/20 (40%)
C2H2 Zn finger 521..541 CDD:275368 6/19 (32%)
C2H2 Zn finger 549..569 CDD:275368 10/17 (59%)
C2H2 Zn finger 577..597 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.