DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and ZBTB2

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_065912.1 Gene:ZBTB2 / 57621 HGNCID:20868 Length:514 Species:Homo sapiens


Alignment Length:403 Identity:79/403 - (19%)
Similarity:125/403 - (31%) Gaps:163/403 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 IINSASSEDQNQDSTPE--FDQDNG-----ITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEE-- 388
            :|..||...|...|.|:  |...:.     |..:.:::..:|..:.||           ||.:  
Human   107 LIQEASLASQGAFSHPDQVFPLASSLYGIQIADHQLRQATKIASAPEK-----------LGRDPR 160

  Fly   389 -----ISQEQ-----QVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRIT 443
                 |||||     |:.....|  :.:..:.:.....||:...|.|||   .:..|.|..|..|
Human   161 PQTSRISQEQVPEASQLSQLTSN--LAQVNRTNMTPSDPLQTSLSPELV---STPVPPPPPGEET 220

  Fly   444 D-------------TV---------------KSFQCHLCPVAFPTQKLLTRHHNTH--------- 471
            :             |:               |.:.||||...|..:..|..|...|         
Human   221 NLEASSSDEQPASLTIAHVKPSIMKRNGSFPKYYACHLCGRRFTLRSSLREHLQIHTGVPFTSSQ 285

  Fly   472 ------------------------------------------------------------IKGLK 476
                                                                        |..|:
Human   286 QGESRVPLTLCSNAADLGKDAMEVPEAGMISDSELQHISDSPIIDGQQQSETPPPSDIADIDNLE 350

  Fly   477 SG------KGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRH------ 529
            ..      |....:|..|..:....|..:.||.|||| ||||||.|:.||.:.....||      
Human   351 QADQEREVKRRKYECTICGRKFIQKSHWREHMYIHTG-KPFKCSTCDKSFCRANQAARHVCLNQS 414

  Fly   530 MDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGV 594
            :||:|.|.:.....|:  |.:.|.:...:    :..::.:||:||.::|:..:.:.:|       
Human   415 IDTYTMVDKQTLELCT--FEEGSQMDNML----VQTNKPYKCNLCDKTFSTPNEVVKH------- 466

  Fly   595 MFSCKQCGRQFND 607
                 .|..|.:|
Human   467 -----SCQNQNSD 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 28/156 (18%)
C2H2 Zn finger 485..505 CDD:275368 5/19 (26%)
zf-H2C2_2 497..522 CDD:290200 15/24 (63%)
C2H2 Zn finger 513..533 CDD:275368 8/25 (32%)
zf-H2C2_2 526..550 CDD:290200 8/29 (28%)
C2H2 Zn finger 541..562 CDD:275368 3/20 (15%)
C2H2 Zn finger 571..591 CDD:275368 5/19 (26%)
C2H2 Zn finger 598..617 CDD:275368 3/10 (30%)
ZBTB2NP_065912.1 BTB 14..>84 CDD:306997
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..231 21/97 (22%)
C2H2 Zn finger 256..276 CDD:275368 7/19 (37%)
zf-C2H2 363..385 CDD:306579 5/21 (24%)
C2H2 Zn finger 365..385 CDD:275368 5/19 (26%)
zf-H2C2_2 377..399 CDD:316026 13/22 (59%)
C2H2 Zn finger 392..443 CDD:275368 14/56 (25%)
C2H2 Zn finger 450..466 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.