DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and ZNF302

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_016882467.1 Gene:ZNF302 / 55900 HGNCID:13848 Length:444 Species:Homo sapiens


Alignment Length:450 Identity:118/450 - (26%)
Similarity:182/450 - (40%) Gaps:109/450 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 RKELAEEVRSQVRDDLRNEVSEDIRKEQLAMLLGE-LEVYLTEKKAGR-WES-LDGSEPETKPQV 240
            :::|.::|..|..::|.:.....:.|..:.|||.: .|.::.|||..: ||| .:..|..||..:
Human    69 QRDLYKDVMVQNYENLVSVAGLSVTKPYVIMLLEDGKEPWMMEKKLSKDWESRWENKELSTKKDI 133

  Fly   241 KEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEV 305
            .::.||           :|..::..:|        :..||         :||:.|::..|.|   
Human   134 YDEDSP-----------QPVTMEKVVK--------QSYEF---------SNSNKNLEYTECD--- 167

  Fly   306 PAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFS 370
                  .||       ...|:        .|..||.||.                         |
Human   168 ------TFR-------STFHS--------KSTLSEPQNN-------------------------S 186

  Fly   371 GEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCP 435
            .|......|::..||.:            ::||..|:....:    .|.....|...|.|..|..
Human   187 AEGNSHKYDILKKNLSK------------KSVIKSERINGGK----KLLNSNKSGAAFNQSKSLT 235

  Fly   436 QPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKR 500
            .|:|   .:..|.:.|..|..||..|.:|:||...| .|.|     ..:|..|....|..|||.|
Human   236 LPQT---CNREKIYTCSECGKAFGKQSILSRHWRIH-TGEK-----PYECRECGKTFSHGSSLTR 291

  Fly   501 HMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGN 565
            |.|.|:|.||:||.||..:||....|..|..||||.|.::|..|...|::.|.|.||: |:|...
Human   292 HQISHSGEKPYKCIECGKAFSHGSSLTNHQSTHTGEKPYECMNCGKSFSRVSLLIQHL-RIHTQE 355

  Fly   566 SRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTTMHKVKNK 624
            .| ::|.:|.::|.|.|.|..|..:|.|.. :.|::||:.|...|.:.:| ..:|.:|.|
Human   356 KR-YECRICGKAFIHSSSLIHHQKSHTGEKPYECRECGKAFCCSSHLTQH-QRIHSMKKK 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 18/67 (27%)
RRF <161..222 CDD:294170 10/43 (23%)
zf-C2H2_8 454..530 CDD:292531 30/75 (40%)
C2H2 Zn finger 485..505 CDD:275368 9/19 (47%)
zf-H2C2_2 497..522 CDD:290200 14/24 (58%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
zf-H2C2_2 526..550 CDD:290200 10/23 (43%)
C2H2 Zn finger 541..562 CDD:275368 8/20 (40%)
C2H2 Zn finger 571..591 CDD:275368 7/19 (37%)
C2H2 Zn finger 598..617 CDD:275368 6/18 (33%)
ZNF302XP_016882467.1 KRAB 48..109 CDD:214630 9/39 (23%)
COG5048 <151..393 CDD:227381 89/326 (27%)
C2H2 Zn finger 248..268 CDD:275368 8/19 (42%)
C2H2 Zn finger 276..296 CDD:275368 9/19 (47%)
C2H2 Zn finger 304..324 CDD:275368 7/19 (37%)
C2H2 Zn finger 332..352 CDD:275368 8/20 (40%)
C2H2 Zn finger 360..380 CDD:275368 7/19 (37%)
C2H2 Zn finger 388..408 CDD:275368 6/20 (30%)
C2H2 Zn finger 416..436 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.