DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and Zbtb8b

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_006239029.1 Gene:Zbtb8b / 500553 RGDID:1562327 Length:515 Species:Rattus norvegicus


Alignment Length:525 Identity:108/525 - (20%)
Similarity:183/525 - (34%) Gaps:170/525 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 KAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFILGCNT 286
            ::.||..|   ||..:......|:.:..:.:|.......|.:.|    |.||    .:|...|: 
  Rat     8 RSARWRRL---EPGARAPGPSRAAAAGGEMEAQSYSAKLLGELN----EQRK----RDFFCDCS- 60

  Fly   287 DPANNSDVNIDG--LELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPE 349
                   :.::|  .:....:...:...||.:      ::|      ||      :|..:.||..
  Rat    61 -------IIVEGRIFKAHRNILFANSGYFRAL------LIH------YI------QDSGRHSTAS 100

  Fly   350 FD---QDNGITSYNIKEDGEIQFSGEKPEEI---------EDVVVF---------NLGEEISQEQ 393
            .|   .|...|..:....|::...||...|:         .|||.|         ::..::.:|.
  Rat   101 LDIVTSDAFSTILDFLYSGKLDLCGENVIEVMSAASYLQMNDVVNFCKTYIRSSLDICRKMEKEA 165

  Fly   394 QVFSFHENVIIVEKEQNDRDEQTP------------------------LKRKRSS-------ELV 427
            .| :....|.......:..|.::|                        |...|||       |||
  Rat   166 AV-AAAVAVAAAAAAAHQIDSESPSSVLEGTSCGTKSFVSSPVNGEGSLDCTRSSCDDCHPLELV 229

  Fly   428 FKQESS--------CPQPK---------TGRI-TDTVKSFQCHLCPVA-----FPTQKLLTRHHN 469
            .|....        |..|:         ..|: .:|.:..|.:..|:|     .|:.:.|...::
  Rat   230 AKDSQGSGASEGDLCIVPRRVEPKVEFDVARVEVETEEQLQQYAAPLAHAEEVLPSNQALDLTYS 294

  Fly   470 T-HIKG-----LKSG-------------KG--GTLKCPSCALQ--LSCASSLKRH---MIIHTGL 508
            : |:|.     |::|             :|  |.|:.|..|:.  :...:...|.   .::...:
  Rat   295 SYHVKQFLEALLRNGAVQSRDDVDHPFSRGLEGRLEGPGVAVNSVMDVQNDWYREDSGDVLVVPI 359

  Fly   509 KPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHL 573
            |..||..|..:..|:.:||||:.:|||.:.:.|..|...|.::.:|:.|...||. :||...|..
  Rat   360 KLHKCPFCPYTAKQKGILKRHIRSHTGERPYPCETCGKRFTRQEHLRSHALSVHR-SSRPIICKG 423

  Fly   574 CHRSF-NHVS-GLSRHLVTHAGVMFSCKQCGRQFNDRSAVQRHVTTMH-------KVKNKLTDYI 629
            |.|:| :|:| ||.|.     |:..|| .|             ||..|       .|...|.:..
  Rat   424 CRRTFTSHLSQGLRRF-----GLCDSC-TC-------------VTDPHDDDDDLMPVNLSLVEAS 469

  Fly   630 SETNE 634
            ||::|
  Rat   470 SESHE 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 5/21 (24%)
RRF <161..222 CDD:294170 108/525 (21%)
zf-C2H2_8 454..530 CDD:292531 22/106 (21%)
C2H2 Zn finger 485..505 CDD:275368 3/24 (13%)
zf-H2C2_2 497..522 CDD:290200 5/27 (19%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
zf-H2C2_2 526..550 CDD:290200 10/23 (43%)
C2H2 Zn finger 541..562 CDD:275368 5/20 (25%)
C2H2 Zn finger 571..591 CDD:275368 9/21 (43%)
C2H2 Zn finger 598..617 CDD:275368 3/18 (17%)
Zbtb8bXP_006239029.1 BTB 47..151 CDD:279045 26/137 (19%)
BTB 58..155 CDD:197585 21/122 (17%)
COG5048 <357..>431 CDD:227381 25/74 (34%)
C2H2 Zn finger 364..384 CDD:275368 7/19 (37%)
zf-H2C2_2 377..401 CDD:290200 10/23 (43%)
C2H2 Zn finger 392..413 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.