DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and wek

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001260472.1 Gene:wek / 48785 FlyBaseID:FBgn0001990 Length:470 Species:Drosophila melanogaster


Alignment Length:481 Identity:107/481 - (22%)
Similarity:179/481 - (37%) Gaps:115/481 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 RDDLRNEVSEDIRKEQLAMLLGE-LEVYLTEKKAGRWESLDGSEPETKPQVKEDA---------- 244
            |||:..:|.|  |.:.|..::.: .:|.:|.:           |||....:.|:.          
  Fly    17 RDDVVYKVRE--RDDDLVRIISKCFDVEMTLE-----------EPELGSMLCEECYSVIGQLITF 68

  Fly   245 SPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAES 309
            |.|.||.:|:                         |.|..:::|.::.|  :|.|.|:..:|...
  Fly    69 SDSVSKVQAI-------------------------FELLRHSEPQDSQD--LDALRLEYGLPPAC 106

  Fly   310 GEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKE-DGEIQFSGEK 373
            .:|...:     |:..|:: ...::...:..|.:...:|:|:.....|..|:|: :.:.:.....
  Fly   107 KQDLEFL-----DIDDTED-RCSLVEELTISDHSTSPSPDFEAQTVRTRANLKQCNSDPKVLASP 165

  Fly   374 PEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDE----------QTPLKRKR------ 422
            ...|.:|      |.....:|.|:...|..:....::|.:|          ..||||||      
  Fly   166 TASIPEV------ETKRSRRQQFAAKRNSKVYTATESDDEEAILDEDEAVSPPPLKRKRGRPKGS 224

  Fly   423 -------SSELVFKQE-----SSCPQPKT--------GRITDTVKSFQCHLCPVAFPTQKLLTRH 467
                   .|:.|..:|     .|....||        |..:.....:.|.:|...|.:...|.||
  Fly   225 GKQKNVDDSDNVTSREPDDNAKSKQDDKTSELSMSPHGSQSSNFVDYPCKICNETFMSFMALRRH 289

  Fly   468 -HNTHIKGLKSGKGGTLK--CPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRH 529
             |:.|        ||..|  |..|...|...:||..|.::||..||..|..|...|..:..|:.|
  Fly   290 KHDMH--------GGPKKYVCDHCGKGLKTFTSLVEHQLVHTEEKPCICPVCNAGFKNKARLRVH 346

  Fly   530 MDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGV 594
            ..|| |..:.:|..|......::.|.:| ..||. :.|..||.:|.....:.:.|..||:.|.|:
  Fly   347 SQTH-GEPKFECNVCGKKLQTRAILNKH-KYVHT-DERRFKCEVCGSGCKNSTALKIHLLGHTGL 408

  Fly   595 M-FSCKQCGRQFNDRSAVQRHVTTMH 619
            . :.||.||:.|...:..:.|....|
  Fly   409 RPYVCKYCGKAFASNTNCRSHKWKKH 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 13/53 (25%)
RRF <161..222 CDD:294170 9/31 (29%)
zf-C2H2_8 454..530 CDD:292531 24/78 (31%)
C2H2 Zn finger 485..505 CDD:275368 6/19 (32%)
zf-H2C2_2 497..522 CDD:290200 10/24 (42%)
C2H2 Zn finger 513..533 CDD:275368 5/19 (26%)
zf-H2C2_2 526..550 CDD:290200 7/23 (30%)
C2H2 Zn finger 541..562 CDD:275368 4/20 (20%)
C2H2 Zn finger 571..591 CDD:275368 5/19 (26%)
C2H2 Zn finger 598..617 CDD:275368 6/18 (33%)
wekNP_001260472.1 zf-AD 11..80 CDD:214871 18/100 (18%)
C2H2 Zn finger 273..294 CDD:275368 7/20 (35%)
C2H2 Zn finger 302..322 CDD:275368 6/19 (32%)
C2H2 Zn finger 330..350 CDD:275368 5/19 (26%)
C2H2 Zn finger 357..377 CDD:275368 4/20 (20%)
C2H2 Zn finger 385..405 CDD:275368 5/19 (26%)
zf-H2C2_2 397..422 CDD:290200 10/24 (42%)
C2H2 Zn finger 413..429 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24377
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.