DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and CG4360

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_650879.1 Gene:CG4360 / 42413 FlyBaseID:FBgn0038787 Length:556 Species:Drosophila melanogaster


Alignment Length:419 Identity:88/419 - (21%)
Similarity:134/419 - (31%) Gaps:162/419 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 FREINMVGSDV-VHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEE 376
            ||:|:.:.:.| :||  ||.....:..::|..|.||    ..|.|.::...|       ...|..
  Fly   179 FRQISTLTNHVKIHT--GEKPFTCNICAKDFRQQST----LINHIKTHKAAE-------SSTPTS 230

  Fly   377 IEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGR 441
            :           ::.:.|..|...     .|.|..:..|...:|.:.|:.::....|.|..:   
  Fly   231 L-----------LNYQPQTGSGKH-----RKSQMHQAYQQQHQRVQISKTLYSGSYSSPAAE--- 276

  Fly   442 ITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHT 506
              :.||.|||.:|...||....|..|..|||      .....||.:|....|..::|..|..|||
  Fly   277 --ELVKPFQCSVCKRRFPQLSTLHNHERTHI------DPKPYKCETCDKSFSQLATLANHKKIHT 333

  Fly   507 GLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQ------------------------------- 540
            |.||:.||.|.:.|.|:..|..|:.|||    ||                               
  Fly   334 GDKPYTCSYCHMQFRQQSTLTNHLKTHT----HQIAPGGVGGAGGGGGAVTATVDHSMPAPLAPG 394

  Fly   541 ----------------------------------------------------------------- 540
                                                                             
  Fly   395 TQQLTSGLLPNNLHGSTANIIQLDHHPLLHFLDGSTTVSSVVATAAANTKVEHFQAGGSPSGRMT 459

  Fly   541 ------------------CPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRH 587
                              |..|...|:|:|.|..|| :.|.| .:.:||.:|..:|..|:.|:.|
  Fly   460 VVGTINMLKGDNPDRPFGCSVCQRFFSQQSTLVNHI-KTHTG-EKPYKCKICEVNFRQVATLNNH 522

  Fly   588 LVTHAGVM-FSCKQCGRQFNDRSAVQRHV 615
            :..|.|.. ::|..|.:||..:|.:|.|:
  Fly   523 MKIHTGEKPYNCSFCPKQFRQKSTLQNHL 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 26/75 (35%)
C2H2 Zn finger 485..505 CDD:275368 5/19 (26%)
zf-H2C2_2 497..522 CDD:290200 12/24 (50%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
zf-H2C2_2 526..550 CDD:290200 10/137 (7%)
C2H2 Zn finger 541..562 CDD:275368 8/20 (40%)
C2H2 Zn finger 571..591 CDD:275368 6/19 (32%)
C2H2 Zn finger 598..617 CDD:275368 7/18 (39%)
CG4360NP_650879.1 C2H2 Zn finger 144..164 CDD:275368
zf-H2C2_2 157..181 CDD:290200 1/1 (100%)
C2H2 Zn finger 172..192 CDD:275368 4/12 (33%)
zf-H2C2_2 185..209 CDD:290200 6/25 (24%)
C2H2 Zn finger 200..220 CDD:275368 6/23 (26%)
C2H2 Zn finger 284..304 CDD:275368 6/19 (32%)
zf-C2H2_8 287..363 CDD:292531 30/85 (35%)
C2H2 Zn finger 312..332 CDD:275368 5/19 (26%)
C2H2 Zn finger 340..360 CDD:275368 7/19 (37%)
C2H2 Zn finger 478..498 CDD:275368 8/20 (40%)
zf-H2C2_2 491..515 CDD:290200 9/25 (36%)
C2H2 Zn finger 506..526 CDD:275368 6/19 (32%)
zf-H2C2_2 519..543 CDD:290200 8/23 (35%)
C2H2 Zn finger 534..554 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.