DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and CG4854

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster


Alignment Length:411 Identity:98/411 - (23%)
Similarity:157/411 - (38%) Gaps:128/411 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 ESLDGSEPETKPQVKEDASPSRSKTKALPKRRPS----LVDANLK----ATEARKDAKEEEFILG 283
            |||..:||:...::|.......|::...|.|..:    |:.|.||    ..:..||.||::.   
  Fly    22 ESLMPTEPDFPDKIKRCTGVELSESPDWPNRICTSCALLLRAALKLRSLCQQTEKDLKEQKL--- 83

  Fly   284 CNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTP 348
                    .::||:.:..::|...:                 |::.::     :.:|....||..
  Fly    84 --------QEINIEIVHDEQETKKK-----------------TESRDL-----SKNEATGSDSEL 118

  Fly   349 EFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRD 413
            |::.   :.||::           ..|..|||.. :..|.:|.|..:.:..|:|.          
  Fly   119 EYEY---LDSYDV-----------TLESSEDVAC-SADELVSIEPAISAPEESVY---------- 158

  Fly   414 EQTPLKRKRSSELVFKQESSCPQPKTGRITDT--VKSFQCHLCPVAFPTQKLLTRHHNTHIKGLK 476
                              |..|:|.|....|:  ..||.|::|             :|.:.:.:|
  Fly   159 ------------------SLSPKPVTFEDEDSGQAASFTCNIC-------------NNVYSERVK 192

  Fly   477 SGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQC 541
                                 |..||.:|:..||.:|..|...|.|...|.|||:||||.:.::|
  Fly   193 ---------------------LTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKC 236

  Fly   542 PQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQF 605
            ..|.|.||..|...:| .|:|. |.|.:||..|.|||.:.:.|..||.||.|.. |||:.|.:.|
  Fly   237 DYCDSRFADPSTRIKH-QRIHT-NERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSF 299

  Fly   606 NDRSAVQRHVTTMHKVKNKLT 626
            :     |.|....|:..:|.|
  Fly   300 S-----QLHHKNSHEKSHKRT 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 6/16 (38%)
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 15/75 (20%)
C2H2 Zn finger 485..505 CDD:275368 3/19 (16%)
zf-H2C2_2 497..522 CDD:290200 9/24 (38%)
C2H2 Zn finger 513..533 CDD:275368 8/19 (42%)
zf-H2C2_2 526..550 CDD:290200 12/23 (52%)
C2H2 Zn finger 541..562 CDD:275368 8/20 (40%)
C2H2 Zn finger 571..591 CDD:275368 8/19 (42%)
C2H2 Zn finger 598..617 CDD:275368 5/18 (28%)
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071 9/34 (26%)
C2H2 Zn finger 180..200 CDD:275368 7/53 (13%)
zf-H2C2_2 193..217 CDD:290200 9/23 (39%)
COG5048 201..>258 CDD:227381 23/58 (40%)
C2H2 Zn finger 208..228 CDD:275368 8/19 (42%)
zf-H2C2_2 221..244 CDD:290200 11/22 (50%)
C2H2 Zn finger 236..256 CDD:275368 8/20 (40%)
zf-H2C2_2 251..273 CDD:290200 11/23 (48%)
C2H2 Zn finger 264..284 CDD:275368 8/19 (42%)
zf-H2C2_2 277..301 CDD:290200 11/28 (39%)
C2H2 Zn finger 292..312 CDD:275368 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.