DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and Odj

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster


Alignment Length:409 Identity:95/409 - (23%)
Similarity:145/409 - (35%) Gaps:126/409 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 TKALPKRRPSL-VDANL------KATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAE 308
            |:|:..|:..| ..|||      ||..|.|.:.|...:|   :||....:|      ||:.|..|
  Fly    59 TQAVAFRQRCLETHANLHQRISSKAGVASKGSPEVSPVL---SDPLLKREV------LDDTVDTE 114

  Fly   309 SGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEK 373
                              |:.|:                  .|.|.     ::.:|.:.....||
  Fly   115 ------------------DDKEL------------------LDDDK-----DLMDDDKDFLEDEK 138

  Fly   374 PEEIEDVVVFNLGEEISQEQQVFSFHEN---------VIIVEKEQNDRDEQTPLKRKRSSELVFK 429
            |     ::.:...::|..|.|.|...::         |.:|||    .|...|..|    |.|.|
  Fly   139 P-----ILRYPPAKKIRIEDQNFPNRQSPRVRVKRLRVPVVEK----ADSPPPPPR----EHVRK 190

  Fly   430 QESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSC 494
            .....|:||..|   ::|.:.|..|..:|          |.|                       
  Fly   191 PRKRRPKPKVDR---SIKRYVCDQCGWSF----------NDH----------------------- 219

  Fly   495 ASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDT-HTGVKRHQCPQCSSCFAQKSNLQQHI 558
             |::|.|.:.|...| |.|.||...|....:|:.|:.. |.|.|.:.|..|...||...:..:|.
  Fly   220 -SNMKDHKLRHFEEK-FSCDECGRKFYTMPLLRLHIRVHHKGEKPYVCKFCGMGFANSPSRCRHE 282

  Fly   559 GRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAG---VMFSCKQCGRQFNDRSAVQRHVTTMHK 620
            .::| .|...|.|.:|.:.||...|..:|...|..   .:..|..|.::|.:...:.||.:|.:.
  Fly   283 RQMH-ANELVHPCKICGKRFNSEKGRLKHEEGHKSDQPDVHICLTCNKEFKEAQFLHRHYSTKYH 346

  Fly   621 VK--NKLTDYISETNEFQA 637
            .|  |.|.:...|  |||:
  Fly   347 RKRVNLLVNGPKE--EFQS 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 15/75 (20%)
C2H2 Zn finger 485..505 CDD:275368 3/19 (16%)
zf-H2C2_2 497..522 CDD:290200 9/24 (38%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 8/24 (33%)
C2H2 Zn finger 541..562 CDD:275368 5/20 (25%)
C2H2 Zn finger 571..591 CDD:275368 6/19 (32%)
C2H2 Zn finger 598..617 CDD:275368 5/18 (28%)
OdjNP_650661.1 zf-AD 5..77 CDD:214871 7/17 (41%)
COG5048 <202..343 CDD:227381 42/179 (23%)
C2H2 Zn finger 209..229 CDD:275368 8/53 (15%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
zf-H2C2_2 249..274 CDD:290200 8/24 (33%)
C2H2 Zn finger 265..283 CDD:275368 5/17 (29%)
C2H2 Zn finger 298..314 CDD:275368 4/15 (27%)
zf-C2H2_jaz 322..347 CDD:288983 6/24 (25%)
C2H2 Zn finger 324..343 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.