DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and CG17806

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster


Alignment Length:643 Identity:117/643 - (18%)
Similarity:187/643 - (29%) Gaps:277/643 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LATLCRLCLKEHQDAYAIFDEDDTQLSIPVRLMACVALDAKATDTLPKRICQECRYQLEKSFLFR 74
            :.||||.|.:|.:.|.::||::  ...:...::.......:....:|.|||..|...|..:..||
  Fly     1 MTTLCRTCGQEAEHAKSLFDKE--ARDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAFR 63

  Fly    75 QRC-----QWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIEVQDKVRKLEDEK 134
            :||     .|.||:          ||                                       
  Fly    64 ERCIRTNSSWFEKQ----------GK--------------------------------------- 79

  Fly   135 WREDFKEEQAAEMHKRLVKSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVS 199
             :||...|.|.|.....::||:                                           
  Fly    80 -QEDSDTETAREGGNNRLESRV------------------------------------------- 100

  Fly   200 EDIRKEQLAMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDA 264
             |:....:|                            :||          :.:.||:|...:...
  Fly   101 -DVMPISIA----------------------------QPQ----------RRRILPQRSKKVDGV 126

  Fly   265 NLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNG 329
            .||..|                       ..|..|.:.|..||:                     
  Fly   127 PLKTVE-----------------------TPIYPLVVPEIPPAD--------------------- 147

  Fly   330 EIYIINSASSEDQNQ-DSTPEFDQDNGITSYNIKEDGE--IQFSGEKPEEIEDVVVFNLGEEISQ 391
               :::....||..| .|.|:...|..:.|.|.:|...  .|...|:|..::             
  Fly   148 ---LVDPLRCEDPIQVKSEPQLSSDYPVESMNHEEPASEMPQVMKEEPRTLQ------------- 196

  Fly   392 EQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRI------TDTVKSFQ 450
                       :|.|.::|        :||..|:...::   ||.....:|      |:..|.  
  Fly   197 -----------VIGEVQKN--------RRKPRSKGCLEE---CPGKDMAKIENIDSTTNKTKE-- 237

  Fly   451 CHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLK-----------CPSCALQLSCASSLKRHMII 504
                      :|..||:           |.|..|           |..|....|...:...|:..
  Fly   238 ----------EKYATRN-----------KWGAAKRAYALEHRLYFCDQCGKTFSEKGNFNVHLRR 281

  Fly   505 HTGLKPFKCSECE-LSFSQREVLKRHMD-THTGVKRHQCPQC----SSCFAQKSNLQQH-IGRVH 562
            |.|.|.|:|.||: :.|:| .:|..|:. .|.|...:.|..|    .:|..:.::.:.| ...||
  Fly   282 HKGTKEFQCQECDRMEFTQ-HLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESPVH 345

  Fly   563 MGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTTMH 619
                |.|.|..|.::|...:.|..|:|.|.|.. |.|:.|...||.|:|:..|..:.|
  Fly   346 ----RPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYKSKH 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 21/77 (27%)
vATP-synt_E 109..>244 CDD:304907 11/134 (8%)
RRF <161..222 CDD:294170 2/60 (3%)
zf-C2H2_8 454..530 CDD:292531 20/87 (23%)
C2H2 Zn finger 485..505 CDD:275368 4/19 (21%)
zf-H2C2_2 497..522 CDD:290200 9/25 (36%)
C2H2 Zn finger 513..533 CDD:275368 7/21 (33%)
zf-H2C2_2 526..550 CDD:290200 7/28 (25%)
C2H2 Zn finger 541..562 CDD:275368 4/25 (16%)
C2H2 Zn finger 571..591 CDD:275368 6/19 (32%)
C2H2 Zn finger 598..617 CDD:275368 7/18 (39%)
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 19/73 (26%)
zf-C2H2 260..282 CDD:278523 4/21 (19%)
C2H2 Zn finger 262..282 CDD:275368 4/19 (21%)
C2H2 Zn finger 290..311 CDD:275368 7/21 (33%)
COG5048 <298..>383 CDD:227381 25/89 (28%)
C2H2 Zn finger 319..339 CDD:275368 3/19 (16%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
ZnF_U1 375..407 CDD:197732 9/25 (36%)
C2H2 Zn finger 378..396 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.