DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and nom

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster


Alignment Length:586 Identity:101/586 - (17%)
Similarity:167/586 - (28%) Gaps:261/586 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LATLCRLCLKEH--QDAYAIFDEDDTQLSIPVRLMACVALDAKATDTLPKRICQECRYQLEKSFL 72
            |..:||:|.:..  ..|..:|......:...::|:..:.|  :.....|..:|..|:..|:.:.:
  Fly     2 LINVCRVCGRSRLCPKAVELFKPGRQDILRRIQLITGILL--QQIPNAPDMVCFCCQTDLQSAMI 64

  Fly    73 FRQRCQWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIEVQDKVRKLEDEKWRE 137
            ||::|...:|   |.:.||                               ..|||...|::|   
  Fly    65 FRRQCILQQK---KWVPLL-------------------------------QSDKVGASEEKK--- 92

  Fly   138 DFKEEQAAEMHKRLVKSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVSEDI 202
                                             .|......:|:..:..|.:.|           
  Fly    93 ---------------------------------VEPNDPSTKKKTTKRRRGRPR----------- 113

  Fly   203 RKEQLAMLLGELEVYLT-EKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANL 266
                  |.|..:::.:| |.||...||:.|.|.:...::.                         
  Fly   114 ------MPLEIVDIVVTNESKASAGESVGGDEFDQPVEIS------------------------- 147

  Fly   267 KATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEI 331
                              |...|.:||||::.::|.:|...||..|...:.      :|..:...
  Fly   148 ------------------NEPDATDSDVNLEEIDLPDEDGLESDHDLPNVQ------IHKCDTCG 188

  Fly   332 YIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVF 396
            .|.|:.||..::|     |:. |||..|..||                                 
  Fly   189 IIKNNKSSLVRHQ-----FEH-NGIRPYPCKE--------------------------------- 214

  Fly   397 SFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQ 461
                                                                     ||..|...
  Fly   215 ---------------------------------------------------------CPKTFLVA 222

  Fly   462 KLLTRHHNTHIKGLKSGKGGTLK----CPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQ 522
            ..|..|:.||         .||:    |..|..:.......|:|..:||..:||.|.:|..:|::
  Fly   223 SELKAHNLTH---------HTLEPPFACRYCDRRYFSVVGRKKHERVHTNERPFVCDQCGKAFTR 278

  Fly   523 REVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRH 587
            ..:||.||..|..|:::.|..|...|:.|.:|..|.      .|.|||     |:...|:..|.:
  Fly   279 TCILKAHMAVHQVVRKYSCDVCDRSFSLKKHLATHF------ISNTHK-----RNAEAVTSSSEY 332

  Fly   588 L 588
            :
  Fly   333 M 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 15/74 (20%)
vATP-synt_E 109..>244 CDD:304907 19/135 (14%)
RRF <161..222 CDD:294170 8/61 (13%)
zf-C2H2_8 454..530 CDD:292531 22/79 (28%)
C2H2 Zn finger 485..505 CDD:275368 4/19 (21%)
zf-H2C2_2 497..522 CDD:290200 9/24 (38%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
zf-H2C2_2 526..550 CDD:290200 9/23 (39%)
C2H2 Zn finger 541..562 CDD:275368 6/20 (30%)
C2H2 Zn finger 571..591 CDD:275368 3/18 (17%)
C2H2 Zn finger 598..617 CDD:275368
nomNP_001262384.1 zf-AD 5..76 CDD:214871 15/75 (20%)
C2H2 Zn finger 184..204 CDD:275368 6/24 (25%)
C2H2 Zn finger 212..261 CDD:275368 15/147 (10%)
zf-H2C2_2 255..278 CDD:290200 9/22 (41%)
C2H2 Zn finger 269..289 CDD:275368 7/19 (37%)
zf-H2C2_2 282..305 CDD:290200 8/22 (36%)
C2H2 Zn finger 297..313 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.