Sequence 1: | NP_732827.1 | Gene: | CG31365 / 42736 | FlyBaseID: | FBgn0051365 | Length: | 639 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001093930.1 | Gene: | Zbtb42 / 382639 | MGIID: | 3644133 | Length: | 420 | Species: | Mus musculus |
Alignment Length: | 254 | Identity: | 62/254 - (24%) |
---|---|---|---|
Similarity: | 94/254 - (37%) | Gaps: | 61/254 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 351 DQDNGITSYNIKEDGEIQFSGEKPEEIEDV--VVFNLGEEISQEQQVFSFHENVIIVEKEQ---N 410
Fly 411 DRDEQTPLKRKRSSELVFKQESSCPQPKTGRITD--------------------TVKSFQ----- 450
Fly 451 ----CHLCPVAFPTQKLLTRHHNTH------IKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIH 505
Fly 506 TGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMG 564 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31365 | NP_732827.1 | zf-AD | 13..86 | CDD:214871 | |
vATP-synt_E | 109..>244 | CDD:304907 | |||
RRF | <161..222 | CDD:294170 | |||
zf-C2H2_8 | 454..530 | CDD:292531 | 27/81 (33%) | ||
C2H2 Zn finger | 485..505 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 497..522 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 513..533 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 526..550 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 541..562 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 571..591 | CDD:275368 | |||
C2H2 Zn finger | 598..617 | CDD:275368 | |||
Zbtb42 | NP_001093930.1 | BTB | 14..114 | CDD:279045 | |
BTB | 25..121 | CDD:197585 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 127..204 | 5/29 (17%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 222..247 | 7/24 (29%) | |||
C2H2 Zn finger | 294..314 | CDD:275368 | 7/19 (37%) | ||
COG5048 | 334..>388 | CDD:227381 | 23/53 (43%) | ||
C2H2 Zn finger | 334..354 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 347..369 | CDD:290200 | 10/21 (48%) | ||
C2H2 Zn finger | 362..382 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 390..408 | CDD:275368 | 6/17 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |