DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and Bcl6b

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001101749.1 Gene:Bcl6b / 360551 RGDID:1563179 Length:472 Species:Rattus norvegicus


Alignment Length:405 Identity:81/405 - (20%)
Similarity:135/405 - (33%) Gaps:112/405 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 SEPETKPQVKEDASPSRS--------KTKALPKRRPSLVDANLKATEARKDAKEEEFILGCNTDP 288
            :||...|.|....||.||        ::::..:..||....:.||.    :.|:.:||:      
  Rat   147 AEPPRPPTVPPPGSPRRSEGHPDPPTESRSCSQGSPSPASPDPKAC----NWKKYKFIV------ 201

  Fly   289 ANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQD 353
                 :|....:........||:...:..:...|..         .:|:||....:.:||.....
  Rat   202 -----LNSQSSQAGSLAGESSGQPCPQARLPSGDEA---------CSSSSSSSSEEGATPGLQSR 252

  Fly   354 NGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPL 418
            ..:.:...:                    |..| .::....:|                   ||.
  Rat   253 LSLATTTAR--------------------FKCG-ALANNSYLF-------------------TPP 277

  Fly   419 KRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSG----- 478
            .::.|.:......|.|              ..|..|..               :.|..||     
  Rat   278 AQETSKQAHPPPGSEC--------------LSCQNCEA---------------VAGCSSGIEPLA 313

  Fly   479 ---KGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQ 540
               :....||..|........:|..|..:|||.||::||.|...|::...||.|...|:|.|.::
  Rat   314 PGDEDKPYKCQLCRSAFRYKGNLASHRTVHTGEKPYRCSVCGARFNRPANLKTHSRIHSGEKPYK 378

  Fly   541 CPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQ 604
            |..|.|.|.|.::|:.|: .:|.| .:.:.|..|...|.|:..|..|:..|.|.. :.|..||..
  Rat   379 CETCGSRFVQVAHLRAHV-LIHTG-EKPYPCPTCGTRFRHLQTLKSHVRIHTGEKPYHCDPCGLH 441

  Fly   605 FNDRSAVQRHVTTMH 619
            |..:|.::.|:...|
  Rat   442 FRHKSQLRLHLRQKH 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 4/11 (36%)
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 20/83 (24%)
C2H2 Zn finger 485..505 CDD:275368 4/19 (21%)
zf-H2C2_2 497..522 CDD:290200 11/24 (46%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
zf-H2C2_2 526..550 CDD:290200 10/23 (43%)
C2H2 Zn finger 541..562 CDD:275368 7/20 (35%)
C2H2 Zn finger 571..591 CDD:275368 6/19 (32%)
C2H2 Zn finger 598..617 CDD:275368 6/18 (33%)
Bcl6bNP_001101749.1 BTB 28..132 CDD:279045
BTB 39..131 CDD:197585
C2H2 Zn finger 323..343 CDD:275368 4/19 (21%)
zf-H2C2_2 335..360 CDD:290200 11/24 (46%)
C2H2 Zn finger 351..371 CDD:275368 7/19 (37%)
zf-H2C2_2 363..388 CDD:290200 10/24 (42%)
C2H2 Zn finger 379..399 CDD:275368 7/20 (35%)
zf-H2C2_2 391..416 CDD:290200 7/26 (27%)
C2H2 Zn finger 407..427 CDD:275368 6/19 (32%)
zf-H2C2_2 420..444 CDD:290200 8/23 (35%)
C2H2 Zn finger 435..453 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.