DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and CG1663

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_610521.1 Gene:CG1663 / 36012 FlyBaseID:FBgn0033449 Length:387 Species:Drosophila melanogaster


Alignment Length:389 Identity:83/389 - (21%)
Similarity:123/389 - (31%) Gaps:120/389 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 NNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQDN 354
            |.|..|.|..|:.:||..|.      .|::.:.:..         .|..:|.|......||    
  Fly    10 NESGFNADEDEIQDEVQVEM------TNLLAASIAQ---------ESKLAEVQESFKNVEF---- 55

  Fly   355 GITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSF--------------------H 399
                  ::|:.|..||.|| |:..|.:..|...:....|...:|                    |
  Fly    56 ------MEEEVEPNFSPEK-EQGHDELASNSHHDYISNQPHKAFYSLQRTSPGVIQYFIQQLRRH 113

  Fly   400 ENVIIVEKEQNDRDEQTPLKRKRSS---------------------------ELVFKQESS---C 434
            :...|.|...|.:|.....::...:                           :.|.:..||   |
  Fly   114 KFFWITEHGINKKDRMDSSQKVAEALFHRFHFQLDPKVVNASARFLQVWFERQYVMQLSSSDFRC 178

  Fly   435 PQPK----------TGRITDTV----------------KSFQ---------CHLCPVAFPTQKLL 464
            ..||          |..|:.|:                ..|:         ||:|..:||....|
  Fly   179 RYPKYYHSLLKFMPTNHISVTICEECDRRFLNERLLRLHKFRVHGGPNPNVCHVCHQSFPLASKL 243

  Fly   465 TRHH-NTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKR 528
            .:|. ..|.|..:      .:|..|..........::|..:|.|.:.:.|..|..|......|..
  Fly   244 EQHQARYHFKRPE------WQCSRCDYNAPSKWDFQQHQAMHAGQRNYICELCGHSSKTSSALAV 302

  Fly   529 HMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNS-RTHKCHLCHRSFNHVSGLSRHLVTH 591
            |..||...|. .||.||..|.:.|.|:.||.::|.||| |...|..|.|.|..:..|..|.:.|
  Fly   303 HRRTHDQPKL-CCPHCSRQFRENSTLKSHIRKIHDGNSARQVSCDFCWRRFKTLELLKLHKLVH 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 16/76 (21%)
C2H2 Zn finger 485..505 CDD:275368 3/19 (16%)
zf-H2C2_2 497..522 CDD:290200 6/24 (25%)
C2H2 Zn finger 513..533 CDD:275368 5/19 (26%)
zf-H2C2_2 526..550 CDD:290200 10/23 (43%)
C2H2 Zn finger 541..562 CDD:275368 9/20 (45%)
C2H2 Zn finger 571..591 CDD:275368 6/19 (32%)
C2H2 Zn finger 598..617 CDD:275368
CG1663NP_610521.1 MttA_Hcf106 <33..>91 CDD:294511 15/77 (19%)
C2H2 Zn finger 201..222 CDD:275368 1/20 (5%)
C2H2 Zn finger 259..279 CDD:275368 3/19 (16%)
C2H2 Zn finger 287..307 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..335 CDD:275368 9/20 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.