DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and esg

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster


Alignment Length:482 Identity:103/482 - (21%)
Similarity:167/482 - (34%) Gaps:151/482 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 EDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVP 306
            ||....::.:|...|:||  |:...:|.:...           || |....|:.:..:|:.||.|
  Fly     5 EDMLVEKNYSKCPLKKRP--VNYQFEAPQNHS-----------NT-PNEPQDLCVKKMEILEENP 55

  Fly   307 AESGEDFREINM------VGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQD-NGITSYNIKED 364
            :|     ..||:      .|.||.|||:..|        |::::|...:.|.| |...:..:...
  Fly    56 SE-----ELINVSDCCEDEGVDVDHTDDEHI--------EEEDEDVDVDVDSDPNQTQAAALAAA 107

  Fly   365 GEIQFSGEKPEEIEDVVV------------FNLG-------EEISQE-QQVFSFHENVIIVEKEQ 409
            ..:..:.     ...|||            |::.       ..|:|: .|:.....::|......
  Fly   108 AAVAAAA-----AASVVVPTPTYPKYPWNNFHMSPYTAEFYRTINQQGHQILPLRGDLIAPSSPS 167

  Fly   410 NDRDEQTP-----LKRKRS-------SELV-----FKQESSCPQPK------TGRITDTVKSFQC 451
            :.....:|     |..:.|       ||::     .:|....|.|:      .|..|.|    ..
  Fly   168 DSLGSLSPPPHHYLHGRASSVSPPMRSEIIHRPIGVRQHRFLPYPQMPGYPSLGGYTHT----HH 228

  Fly   452 HLCPV-----------------------AFPTQKLLTRHHNTHIKGLKSGKGG------------ 481
            |..|:                       :.| :.|..:|.|.:: .|.:.:.|            
  Fly   229 HHAPISPAYSENSYYSMRSMTPESSCSSSLP-EDLSLKHKNLNL-NLNTSQPGEQAAAKTGDMSP 291

  Fly   482 ----------------TLKCPSCALQLSCASSLKRHMIIHTGL-------KPFKCSECELSFSQR 523
                            ..:||.|....|..|.|.:|...|...       |.|.|.:|:.::...
  Fly   292 ETMPNASAKKDKNQPPRYQCPDCQKSYSTFSGLTKHQQFHCPAAEGNQVKKSFSCKDCDKTYVSL 356

  Fly   524 EVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHL 588
            ..||.|:.|||  ...:|..|...|::...||.|| |.|.| .:...|..|||:|...|.|..||
  Fly   357 GALKMHIRTHT--LPCKCNLCGKAFSRPWLLQGHI-RTHTG-EKPFSCQHCHRAFADRSNLRAHL 417

  Fly   589 VTHAGV-MFSCKQCGRQFNDRSAVQRH 614
            .||:.: .:||..|.:.|:..|.:.:|
  Fly   418 QTHSDIKKYSCTSCSKTFSRMSLLTKH 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 1/1 (100%)
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 21/133 (16%)
C2H2 Zn finger 485..505 CDD:275368 7/19 (37%)
zf-H2C2_2 497..522 CDD:290200 7/31 (23%)
C2H2 Zn finger 513..533 CDD:275368 5/19 (26%)
zf-H2C2_2 526..550 CDD:290200 9/23 (39%)
C2H2 Zn finger 541..562 CDD:275368 8/20 (40%)
C2H2 Zn finger 571..591 CDD:275368 9/19 (47%)
C2H2 Zn finger 598..617 CDD:275368 5/17 (29%)
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 7/21 (33%)
C2H2 Zn finger 311..331 CDD:275370 7/19 (37%)
zf-C2H2 344..366 CDD:278523 6/21 (29%)
C2H2 Zn finger 346..366 CDD:275368 5/19 (26%)
zf-C2H2 370..392 CDD:278523 8/22 (36%)
C2H2 Zn finger 372..392 CDD:275368 8/20 (40%)
zf-H2C2_2 385..408 CDD:290200 11/24 (46%)
zf-C2H2 398..420 CDD:278523 9/21 (43%)
C2H2 Zn finger 400..420 CDD:275368 9/19 (47%)
C2H2 Zn finger 428..444 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.