DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and CG11696

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster


Alignment Length:716 Identity:143/716 - (19%)
Similarity:235/716 - (32%) Gaps:240/716 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LCRLCLKEHQDAYAIFDED-------DTQLS--IPVRLMACVALDAKATDTLPKRICQECRYQLE 68
            :|||||::.:....||.::       ..||:  |...|:..:|    ..|.:...:|..|..||.
  Fly     2 ICRLCLEDAEHGVPIFGQEPPMGQPAHRQLAELIERHLLLVLA----ENDVVSTCLCNRCWRQLA 62

  Fly    69 KSFLFRQRCQWAEKKLRKHIRLLGLGKRSRVFSK--DPD----------------DYDEDELEFE 115
            :   ..|.|....:|.|...|.|.|........:  :|:                .|:.|::  :
  Fly    63 E---IEQFCSMVAEKQRSLHRSLQLKTELPELPELTEPEPALVVWNTESPIEPKLSYEGDDI--K 122

  Fly   116 DSIAFIEVQDKVRKLEDEK-------WREDFKEE----QAAEMHKRLVKSRLELRAKLTT----- 164
            |.|....|.|.: ...|||       :..||:.|    :..|.....||.|...|.:.|.     
  Fly   123 DHILCEPVIDAL-SAGDEKDSDYGDTFEPDFEPESQPDEEEEPEPDPVKPRPRGRPRKTALQQTH 186

  Fly   165 ELRKELAEEVRSEVRKELAE----EVRSQVRDDLRNEVSEDIRKEQLAMLLGELEVYLTEKKAGR 225
            ::.|...|:.:.:.:.::.|    |.|::.|:                         |....||.
  Fly   187 QIIKRKYEKRKQQNKAKITELSLRESRARQRE-------------------------LKRSSAGA 226

  Fly   226 WESLDGSE-------------PETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEA---RKD 274
            .:..||.|             |:...|.|......|.|||.|     ...|.|...:|.   |..
  Fly   227 EDDQDGDEDEEDEEDVGGELTPDADEQPKPRGKRGRPKTKKL-----VTADDNDDTSEVPVKRSS 286

  Fly   275 AKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASS 339
            .||.:..:..|             ::||..:.|...|||.::.. ...|.|...|.:...|:...
  Fly   287 IKEMDDYIAAN-------------VKLDCAICAAPLEDFNDLKR-HFRVEHDCTGYVKCCNNRYK 337

  Fly   340 ------EDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSF 398
                  :..:....|::                  ||.:...:       |.....||...:..|
  Fly   338 KRTLYVDHLHCHKDPQY------------------FSCQSCRK-------NFLNRNSQVMHMLRF 377

  Fly   399 HENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKL 463
            |                     .:..|||                     .||.:|...|..:.|
  Fly   378 H---------------------SQQQELV---------------------HQCAICEARFAKKFL 400

  Fly   464 LTRHHNTHIKGLKSGKGGTLK---CPSCA------LQLS------------------CASSL--K 499
            ||    .|:||.|    ||.:   |.:|:      .:||                  |.:..  |
  Fly   401 LT----MHLKGHK----GTERPEVCDTCSKTFRTKFELSAHVKRMHAADFTPIICDICGTHFRSK 457

  Fly   500 RHMIIH-TGLKP------FKCSECELSFSQREVLKRHM---DTHTGVKRHQCPQCSSCFAQKSNL 554
            .:.:|| ..|.|      .:|:.|.........|::|:   |...|..:::|..|::..:.::.|
  Fly   458 ANFLIHKKALHPDGPVAEVQCTLCGRWLRDERSLRKHLARHDDRDGDTKYRCLLCNAEKSSRAAL 522

  Fly   555 QQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGV-MFSCKQCGRQFNDRSAVQRHVTTM 618
            ..|:...|  :::.|||.||.:.|.....|:.|:.||.|: ::.|:.|.|.|...:.:..|...|
  Fly   523 SSHMRYHH--SAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFCTRTFKSHANMHNHKKKM 585

  Fly   619 H 619
            |
  Fly   586 H 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 20/81 (25%)
vATP-synt_E 109..>244 CDD:304907 32/167 (19%)
RRF <161..222 CDD:294170 8/69 (12%)
zf-C2H2_8 454..530 CDD:292531 24/111 (22%)
C2H2 Zn finger 485..505 CDD:275368 6/45 (13%)
zf-H2C2_2 497..522 CDD:290200 7/33 (21%)
C2H2 Zn finger 513..533 CDD:275368 5/22 (23%)
zf-H2C2_2 526..550 CDD:290200 6/26 (23%)
C2H2 Zn finger 541..562 CDD:275368 4/20 (20%)
C2H2 Zn finger 571..591 CDD:275368 6/19 (32%)
C2H2 Zn finger 598..617 CDD:275368 5/18 (28%)
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 21/82 (26%)
C2H2 Zn finger 332..349 CDD:275368 1/16 (6%)
C2H2 Zn finger 357..378 CDD:275368 3/27 (11%)
C2H2 Zn finger 388..408 CDD:275368 8/23 (35%)
C2H2 Zn finger 417..438 CDD:275368 4/20 (20%)
C2H2 Zn finger 447..465 CDD:275368 4/17 (24%)
C2H2 Zn finger 478..498 CDD:275368 4/19 (21%)
C2H2 Zn finger 509..529 CDD:275368 4/19 (21%)
C2H2 Zn finger 537..557 CDD:275368 6/19 (32%)
C2H2 Zn finger 565..583 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.