DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and CG2120

DIOPT Version :10

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster


Alignment Length:293 Identity:74/293 - (25%)
Similarity:107/293 - (36%) Gaps:87/293 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 DNGITSYNI-KEDGEI-----QFSGEK-PEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQN 410
            |:.:.:|:: .||.::     ..|||: |.|:|   :.|.|.|....:.|     |..:   :|.
  Fly    17 DDDLGNYDVCLEDLQLFAQLEDLSGERLPMEME---LLNPGSEYDLLELV-----NGAL---QQR 70

  Fly   411 DRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGL 475
            :..|..|                         ||..|       |...||.|   ||..|     
  Fly    71 NTTEHKP-------------------------TDMCK-------PKRTPTTK---RHRTT----- 95

  Fly   476 KSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQ 540
              ||..|  |..|..:.|.|.:|:.|.:.||..||..|.||...|.|...|:.|..|||..:.|:
  Fly    96 --GKDHT--CDICDRRFSEAYNLRIHKMTHTDEKPHVCVECGKGFRQLNKLRIHAVTHTAERPHK 156

  Fly   541 CPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHL--CHRSFNHVSGLSRHL-VTHA---------- 592
            |..|...|...:.|..| .|:|.| .:.:.|..  ||.||:.:.....|. :.||          
  Fly   157 CDICGKGFRYANYLTVH-RRLHTG-EKPYPCLATDCHLSFHSIHARRIHTKLRHAAQTDPDPEHP 219

  Fly   593 ----------GVMFSCKQCGRQFNDRSAVQRHV 615
                      .:.|:|..|.|...|:..:..|:
  Fly   220 LAEQEQRDTSALSFTCPVCSRVLTDQCYLSIHL 252

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871