DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and Zbtb7b

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_038957970.1 Gene:Zbtb7b / 295248 RGDID:1305963 Length:597 Species:Rattus norvegicus


Alignment Length:401 Identity:97/401 - (24%)
Similarity:139/401 - (34%) Gaps:136/401 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 LEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEE 278
            ||.:.|.........:...| ::.|||.....|.       |..||          .||:..|..
  Rat   217 LEAFATATTTASTSGMPNGE-DSPPQVPLLPPPP-------PPPRP----------VARRSRKPR 263

  Fly   279 EFILGCNTDPANNSDVNIDGLELDEEVPAESGED--FREINMVGSDVVHTDNGEIYIINSASSED 341
            :..|......||:         |..|.|......  :.|..|||.           :.||..|..
  Rat   264 KAFLQTKGARANH---------LVPEAPTVLTHPLAYEEEEMVGR-----------VGNSGGSGL 308

  Fly   342 QNQDSTPEFDQDNGITSYNIKEDGEIQ---FSGEKPEEIEDVV---VFNLG---------EEISQ 391
            .:..|.|.     |.||   ..:|.:.   |.||  ||.|::|   .:.|.         ||:..
  Rat   309 GDNYSPPA-----GATS---PAEGPLNYEVFEGE--EEEEELVYPPAYGLAQSNEPSLSPEELGS 363

  Fly   392 EQQ---------VFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVK 447
            ::.         :.|.|::.:     ....|.|..|.|||.|::        ||           
  Rat   364 DEDPIDPDLMAYLSSLHQDAL-----APGLDGQDKLVRKRRSQM--------PQ----------- 404

  Fly   448 SFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFK 512
                                                :||.|...:..|..|.|||..|||.|||.
  Rat   405 ------------------------------------ECPVCHKIIHGAGKLPRHMRTHTGEKPFA 433

  Fly   513 CSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRS 577
            |..|.:.|::.:.||.||..|||.:.:.||.|.:.|....:|:.|: .:|.|: |.::|||||::
  Rat   434 CEVCGVRFTRNDKLKIHMRKHTGERPYSCPHCPARFLHSYDLKNHM-HLHTGD-RPYECHLCHKA 496

  Fly   578 FNHVSGLSRHL 588
            |.....|.|||
  Rat   497 FAKEDHLQRHL 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 7/29 (24%)
RRF <161..222 CDD:294170 3/7 (43%)
zf-C2H2_8 454..530 CDD:292531 19/75 (25%)
C2H2 Zn finger 485..505 CDD:275368 8/19 (42%)
zf-H2C2_2 497..522 CDD:290200 13/24 (54%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
zf-H2C2_2 526..550 CDD:290200 11/23 (48%)
C2H2 Zn finger 541..562 CDD:275368 6/20 (30%)
C2H2 Zn finger 571..591 CDD:275368 10/18 (56%)
C2H2 Zn finger 598..617 CDD:275368
Zbtb7bXP_038957970.1 BTB_POZ_ZBTB7B_ZBTB15 63..196 CDD:349636
COG5048 403..>482 CDD:227381 32/126 (25%)
C2H2 Zn finger 406..426 CDD:275368 8/19 (42%)
zf-H2C2_2 421..443 CDD:404364 12/21 (57%)
C2H2 Zn finger 434..454 CDD:275368 7/19 (37%)
C2H2 Zn finger 462..482 CDD:275368 6/20 (30%)
zf-H2C2_2 474..499 CDD:404364 11/26 (42%)
C2H2 Zn finger 490..508 CDD:275368 10/18 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.