Sequence 1: | NP_732827.1 | Gene: | CG31365 / 42736 | FlyBaseID: | FBgn0051365 | Length: | 639 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_700447.2 | Gene: | Zbtb24 / 268294 | MGIID: | 3039618 | Length: | 710 | Species: | Mus musculus |
Alignment Length: | 322 | Identity: | 86/322 - (26%) |
---|---|---|---|
Similarity: | 130/322 - (40%) | Gaps: | 86/322 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 329 GEIYI-INSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQE 392
Fly 393 QQVFSFHENVIIVEKEQN---------------------------------DRDEQTPLKRKRSS 424
Fly 425 ELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCA 489
Fly 490 LQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNL 554
Fly 555 QQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHV 615 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31365 | NP_732827.1 | zf-AD | 13..86 | CDD:214871 | |
vATP-synt_E | 109..>244 | CDD:304907 | |||
RRF | <161..222 | CDD:294170 | |||
zf-C2H2_8 | 454..530 | CDD:292531 | 19/75 (25%) | ||
C2H2 Zn finger | 485..505 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 497..522 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 513..533 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 526..550 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 541..562 | CDD:275368 | 9/20 (45%) | ||
C2H2 Zn finger | 571..591 | CDD:275368 | 10/19 (53%) | ||
C2H2 Zn finger | 598..617 | CDD:275368 | 7/18 (39%) | ||
Zbtb24 | NP_700447.2 | BTB | 27..128 | CDD:279045 | |
BTB | 38..133 | CDD:197585 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 134..176 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 202..256 | 12/65 (18%) | |||
C2H2 Zn finger | 295..315 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 308..332 | CDD:290200 | 7/29 (24%) | ||
COG5048 | <320..479 | CDD:227381 | 52/135 (39%) | ||
C2H2 Zn finger | 323..343 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 335..360 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 351..371 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 363..388 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 379..399 | CDD:275368 | 9/20 (45%) | ||
COG5048 | 406..>563 | CDD:227381 | 21/47 (45%) | ||
C2H2 Zn finger | 407..427 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 420..443 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 435..455 | CDD:275368 | 7/18 (39%) | ||
zf-H2C2_2 | 447..471 | CDD:290200 | 2/6 (33%) | ||
C2H2 Zn finger | 463..479 | CDD:275368 | |||
zf-H2C2_2 | 477..500 | CDD:290200 | |||
C2H2 Zn finger | 491..511 | CDD:275368 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 651..676 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |