DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and HIC2

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_055909.2 Gene:HIC2 / 23119 HGNCID:18595 Length:615 Species:Homo sapiens


Alignment Length:429 Identity:92/429 - (21%)
Similarity:144/429 - (33%) Gaps:135/429 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 YLTEKKAGRW-ESLDGSEP-ETKPQVKEDASPSR--------SKTKALPKRRPSLVDA------- 264
            :||...|.:. :|..||.| .:.|.|...||.|.        ...:.......||::|       
Human   264 HLTPDDAAQLSDSQHGSPPAASAPPVANSASYSELGGTPDEPMDLEGAEDNHLSLLEAPGGQPRK 328

  Fly   265 NLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNG 329
            :|:.:..:|:..::|.:.|   .|....:....|     ..|.|.||.      ||         
Human   329 SLRHSTRKKEWGKKEPVAG---SPFERREAGPKG-----PCPGEEGEG------VG--------- 370

  Fly   330 EIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQ 394
                           |..|     |||.:......|..   ||.|...:                
Human   371 ---------------DRVP-----NGILASGAGPSGPY---GEPPYPCK---------------- 396

  Fly   395 VFSFHENVIIVEKEQNDRDEQTPLKRK--------RSSELVFKQESSCPQPKTGRITDTVKSFQC 451
                       |:|:|.:|......:.        .|:..:::||..    :|....|.:  :.|
Human   397 -----------EEEENGKDASEDSAQSGSEGGSGHASAHYMYRQEGY----ETVSYGDNL--YVC 444

  Fly   452 HLCPVAFPTQKLLTRHHNTHIK---------GLKSGKGGT--------------------LKCPS 487
            ..|...||:.:.|..|..||.:         ..::|.||.                    .||..
Human   445 IPCAKGFPSSEQLNAHVETHTEEELFIKEEGAYETGSGGAEEEAEDLSAPSAAYTAEPRPFKCSV 509

  Fly   488 CALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKS 552
            |.......::|::|...|...:||.|:.|...|:||..:.|||.:|.|:|...|.:|...|.::.
Human   510 CEKTYKDPATLRQHEKTHWLTRPFPCNICGKMFTQRGTMTRHMRSHLGLKPFACDECGMRFTRQY 574

  Fly   553 NLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTH 591
            .|.:|: |||.| .:.::|.||...|.....|..||..|
Human   575 RLTEHM-RVHSG-EKPYECQLCGGKFTQQRNLISHLRMH 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 9/28 (32%)
RRF <161..222 CDD:294170 2/4 (50%)
zf-C2H2_8 454..530 CDD:292531 24/104 (23%)
C2H2 Zn finger 485..505 CDD:275368 4/19 (21%)
zf-H2C2_2 497..522 CDD:290200 8/24 (33%)
C2H2 Zn finger 513..533 CDD:275368 8/19 (42%)
zf-H2C2_2 526..550 CDD:290200 9/23 (39%)
C2H2 Zn finger 541..562 CDD:275368 6/20 (30%)
C2H2 Zn finger 571..591 CDD:275368 7/19 (37%)
C2H2 Zn finger 598..617 CDD:275368
HIC2NP_055909.2 BTB 40..140 CDD:279045
BTB 47..141 CDD:197585
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..167
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..208
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..421 40/229 (17%)
Binding to CtBP 246..250
TMEM119 <300..395 CDD:292352 24/140 (17%)
C2H2 Zn finger 444..464 CDD:275368 6/19 (32%)
zf-C2H2 505..527 CDD:278523 5/21 (24%)
C2H2 Zn finger 507..527 CDD:275368 4/19 (21%)
zf-C2H2 533..555 CDD:278523 9/21 (43%)
C2H2 Zn finger 535..555 CDD:275368 8/19 (42%)
zf-H2C2_2 548..572 CDD:290200 9/23 (39%)
COG5048 559..>613 CDD:227381 18/55 (33%)
C2H2 Zn finger 563..583 CDD:275368 6/20 (30%)
zf-H2C2_2 576..600 CDD:290200 10/25 (40%)
C2H2 Zn finger 591..611 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.